BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0784 (818 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48940| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_6198| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-18) 29 6.0 SB_14080| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_48940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 298 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/47 (29%), Positives = 29/47 (61%) Frame = +3 Query: 174 VMESMKNAWNEVVKTLSDAGDAVVHVFKPTEKSVIDKMADSVKSLTQ 314 ++E K A +++ + D G+ V K ++KS+ ++ DSVKS+++ Sbjct: 86 LLEEWKKADVNLLREIRDVGNVVSKEIKDSKKSISKEIQDSVKSVSK 132 >SB_6198| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-18) Length = 347 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +3 Query: 66 IVSVEMDFRLLLLCCL-YIAVVAAAFPSETRNIEKRDVMESMKNAWNEVVKTL 221 + S+ + + L L+C L YI V A +E R + S+ + W EVV+TL Sbjct: 237 VTSMFLVYCLFLVCYLPYIIVQTAILVTELRLFSDPSIHSSL-SVWGEVVETL 288 >SB_14080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1190 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 4/32 (12%) Frame = +2 Query: 209 REDPKRCWRCGRS----RIQANRKECHR*NGR 292 RED K C RCG S +A KEC + NG+ Sbjct: 306 REDRKTCGRCGSSHKPKECKAFGKECFKCNGK 337 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,173,484 Number of Sequences: 59808 Number of extensions: 453792 Number of successful extensions: 1063 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1061 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -