BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0784 (818 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 24 4.9 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.9 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 6.5 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 24.2 bits (50), Expect = 4.9 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 53 RCHANCFC*NGF 88 RC+A C+C +GF Sbjct: 82 RCYAECYCASGF 93 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 4.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 296 TICHFIDDTLFCWLEYVNDRIASIA*GLHDFV 201 T +F DD++ L Y DR+A I H F+ Sbjct: 605 TSINFSDDSMID-LSYSEDRLADITVATHQFI 635 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 6.5 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -3 Query: 360 YCCCNYKVLKSIKPVIASSS*HYLPFYR*HSFLL 259 YC Y +S P+I + H+L Y H F L Sbjct: 746 YCKLMYNRERSYIPLIEAEPKHFLCSYNTHCFAL 779 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 779,643 Number of Sequences: 2352 Number of extensions: 15844 Number of successful extensions: 39 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86902827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -