BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0783 (700 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IBL3 Cluster: Putative uncharacterized protein MAL7P1... 35 2.2 UniRef50_A7EVQ4 Cluster: Predicted protein; n=1; Sclerotinia scl... 35 2.2 UniRef50_Q8IBC6 Cluster: Putative uncharacterized protein MAL8P1... 33 5.1 UniRef50_Q7RDU4 Cluster: Putative uncharacterized protein PY0532... 33 5.1 UniRef50_Q1RPG9 Cluster: Putative uncharacterized protein; n=1; ... 33 8.9 >UniRef50_Q8IBL3 Cluster: Putative uncharacterized protein MAL7P1.127; n=3; Plasmodium|Rep: Putative uncharacterized protein MAL7P1.127 - Plasmodium falciparum (isolate 3D7) Length = 1605 Score = 34.7 bits (76), Expect = 2.2 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 3/65 (4%) Frame = -3 Query: 476 NHSRVSEILGTNMSITF*WEREERSHFYKMATLATKKAYCYTEKRKKKKNSI---DNLNT 306 N + I+ IT WE +++ H Y+ TKK +KRKKKK I +N N Sbjct: 977 NDGDICNIINKKKEITELWENKKKIHVYEQEYNITKK-----KKRKKKKKRIPLWENKNV 1031 Query: 305 INQFN 291 + Q N Sbjct: 1032 VTQSN 1036 >UniRef50_A7EVQ4 Cluster: Predicted protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Predicted protein - Sclerotinia sclerotiorum 1980 Length = 387 Score = 34.7 bits (76), Expect = 2.2 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = -3 Query: 398 FYKMATLATKKAYCYTEKRKKKKNSIDNLNTINQF 294 +Y +T++T YT KRK+++NS +N N ++ + Sbjct: 12 YYSKSTVSTAPEQAYTNKRKREENSFENSNCVSPY 46 >UniRef50_Q8IBC6 Cluster: Putative uncharacterized protein MAL8P1.7; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein MAL8P1.7 - Plasmodium falciparum (isolate 3D7) Length = 2130 Score = 33.5 bits (73), Expect = 5.1 Identities = 26/82 (31%), Positives = 39/82 (47%) Frame = -3 Query: 398 FYKMATLATKKAYCYTEKRKKKKNSIDNLNTINQFNF*FSK*YTGNSYNGRVPKWKIVYK 219 FYK + K + C K+KKK N + +I +FN+ Y NSY ++I Y+ Sbjct: 1222 FYKRRFIKKKISICIQNKKKKKMNIL----SIMKFNYIHDDLYKKNSY----MNYQIFYQ 1273 Query: 218 ILILNKLKRLVRFLIKKIFTCK 153 I I K++ IK I + K Sbjct: 1274 IFIKRNSKKITN--IKNICSYK 1293 >UniRef50_Q7RDU4 Cluster: Putative uncharacterized protein PY05326; n=4; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05326 - Plasmodium yoelii yoelii Length = 508 Score = 33.5 bits (73), Expect = 5.1 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = -3 Query: 473 HSRVSEILGTNMSITF*WEREERSHFYKMATLATKKAYCYTEKRKKKKNSIDNLNTINQF 294 H ++ L +++ + + YK+ K +Y EK+KKKKNS++N N Sbjct: 310 HKILNSWLNKKSNVSLECDISLKEKIYKIIFFMNKISYIVCEKKKKKKNSVNNSYNFNDA 369 Query: 293 NF 288 F Sbjct: 370 LF 371 >UniRef50_Q1RPG9 Cluster: Putative uncharacterized protein; n=1; Escherichia coli|Rep: Putative uncharacterized protein - Escherichia coli Length = 292 Score = 32.7 bits (71), Expect = 8.9 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Frame = -3 Query: 362 YCYTEKRKKKKNSIDNLNTINQFNF*FSK*YTGNSYNGRVPKWKIVYKI--LILNKLKR 192 Y +K +KK++ ID++ I +FNF ++ T R +W Y++ +++KLKR Sbjct: 58 YTKDKKNEKKRDLIDDIIDIERFNFHYNTNATSKRQIVRFEEWVSKYELDFRLISKLKR 116 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 602,355,358 Number of Sequences: 1657284 Number of extensions: 11170778 Number of successful extensions: 25777 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25755 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -