BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0783 (700 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G6.03 |||phosphoprotein phosphatase|Schizosaccharomyces po... 26 4.5 SPAC1B3.06c |||UbiE family methyltransferase |Schizosaccharomyce... 26 6.0 SPAC24H6.05 |cdc25|sal2|serine/threonine protein phosphatase Cdc... 26 6.0 >SPAC17G6.03 |||phosphoprotein phosphatase|Schizosaccharomyces pombe|chr 1|||Manual Length = 635 Score = 26.2 bits (55), Expect = 4.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 456 DTRHQYVNYILVGTRGTKSFLQNGNFG 376 ++RH +YI+V + G + L +G FG Sbjct: 431 ESRHHIPHYIIVNSGGIRGGLNSGAFG 457 >SPAC1B3.06c |||UbiE family methyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 278 Score = 25.8 bits (54), Expect = 6.0 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = -2 Query: 663 LHVICSSGFL-IAFPNTLSDGAPVGVVASIDMIVKPNEVIVNPSLRFKNQSRKGRIRREM 487 L V C G + + FP + +G +GV S +++ K E +LR + +K +I Sbjct: 45 LDVGCGPGTITVGFPKYVPEGEVIGVEPSQELLDKAEE-----ALRKEETLKKEKINNCS 99 Query: 486 FRVKS 472 FR+ S Sbjct: 100 FRLGS 104 >SPAC24H6.05 |cdc25|sal2|serine/threonine protein phosphatase Cdc25|Schizosaccharomyces pombe|chr 1|||Manual Length = 596 Score = 25.8 bits (54), Expect = 6.0 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -2 Query: 648 SSGFLIAFPNTLSDGAPVGVVASIDMIVKPNEVIVNPSLRFKNQS 514 +S F N+L D + IDM+ K N+ I PSL+ ++ S Sbjct: 290 NSDFGACNDNSLDDLFQASPIKPIDMLPKINKDIAFPSLKVRSPS 334 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,642,733 Number of Sequences: 5004 Number of extensions: 51306 Number of successful extensions: 126 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -