BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0783 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0012 - 11791524-11791957,11792014-11792108,11792163-117922... 29 3.5 03_01_0592 + 4372190-4372325,4373646-4373704,4374245-4374355,437... 28 8.2 >10_07_0012 - 11791524-11791957,11792014-11792108,11792163-11792226, 11792327-11792591,11792670-11793127,11793271-11793592 Length = 545 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +1 Query: 532 QTGIHDYFVRLDDHIYRRDNTHRRTVR*CIGESD*KTRGTYYVQRLR 672 QT +H + R+ D I R+ R C+G KTR ++ VQ R Sbjct: 231 QTNLHSFARRMLDIIISREAKEAAETRACLGMPITKTRWSFVVQMSR 277 >03_01_0592 + 4372190-4372325,4373646-4373704,4374245-4374355, 4374441-4374800 Length = 221 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 484 KHFSANSPLSGLVLKPQTGIH 546 KHF A S L GL+ KP +H Sbjct: 5 KHFEAQSTLMGLICKPTRELH 25 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,402,002 Number of Sequences: 37544 Number of extensions: 279461 Number of successful extensions: 492 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -