BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0782 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2... 26 4.1 SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosacc... 26 5.4 SPCC576.09 |rps20||40S ribosomal protein S20|Schizosaccharomyces... 25 9.5 SPCP31B10.02 |||conserved eukaryotic protein|Schizosaccharomyces... 25 9.5 SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosacchar... 25 9.5 >SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 474 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 290 KALGVDFILIVIICVNVSPKYGSDTLINL 376 K LG+DF + +++C +YGS+ L +L Sbjct: 147 KELGIDFPVNLLMCFEGMEEYGSEGLEDL 175 >SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 425 Score = 25.8 bits (54), Expect = 5.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 19 EPKPTSPARGAPCRPTNEALARR 87 EP P S A +P + + EALA R Sbjct: 64 EPSPASSASASPVKKSAEALAER 86 >SPCC576.09 |rps20||40S ribosomal protein S20|Schizosaccharomyces pombe|chr 3|||Manual Length = 118 Score = 25.0 bits (52), Expect = 9.5 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -3 Query: 633 TANGIGFXTYRVLSP-IHSTLI*LTATSYRMSRLIKIHVYHGIAPTIT 493 T NG G T+ IH LI L + S + ++ IH+ G+ +T Sbjct: 68 TPNGEGSKTWETYEMRIHKRLIDLHSPSEIVKQITSIHIEPGVEVEVT 115 >SPCP31B10.02 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 143 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -3 Query: 108 DGGSVTTTPRQSLVCWSAGCAAC 40 DG V P + L C +GCA C Sbjct: 50 DGIRVPPKPEEPLNCCQSGCAIC 72 >SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosaccharomyces pombe|chr 1|||Manual Length = 859 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 631 CEWYRVFXVSSIKSYTFNLNLTYSYELS 548 C +YR F S S F L++ + Y+L+ Sbjct: 518 CHYYRFFRTSHTISRKFMLSIEFIYQLA 545 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,406,887 Number of Sequences: 5004 Number of extensions: 45267 Number of successful extensions: 115 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -