BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0782 (650 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT024277-1|ABC86339.1| 1455|Drosophila melanogaster IP14411p pro... 29 5.5 AY071090-1|AAL48712.2| 1454|Drosophila melanogaster RE15630p pro... 29 5.5 AE014297-3788|AAF56460.1| 1266|Drosophila melanogaster CG11902-P... 29 5.5 >BT024277-1|ABC86339.1| 1455|Drosophila melanogaster IP14411p protein. Length = 1455 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 13 PSEPKPTSPARGAPCRPT-NEALARRGRHGTTV 108 PSEP P RG P P ++A+ GRH V Sbjct: 207 PSEPSPVKRRRGRPPGPAKSQAMTTDGRHACEV 239 >AY071090-1|AAL48712.2| 1454|Drosophila melanogaster RE15630p protein. Length = 1454 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 13 PSEPKPTSPARGAPCRPT-NEALARRGRHGTTV 108 PSEP P RG P P ++A+ GRH V Sbjct: 206 PSEPSPVKRRRGRPPGPAKSQAMTTDGRHACEV 238 >AE014297-3788|AAF56460.1| 1266|Drosophila melanogaster CG11902-PA protein. Length = 1266 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 13 PSEPKPTSPARGAPCRPT-NEALARRGRHGTTV 108 PSEP P RG P P ++A+ GRH V Sbjct: 178 PSEPSPVKRRRGRPPGPAKSQAMTTDGRHACEV 210 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,173,789 Number of Sequences: 53049 Number of extensions: 464130 Number of successful extensions: 1172 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1172 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2765538900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -