BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0775 (717 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0634 - 5511393-5511858,5512581-5512879 30 1.6 12_01_0541 + 4251931-4254141 28 6.4 >08_01_0634 - 5511393-5511858,5512581-5512879 Length = 254 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -3 Query: 448 TPLGSVE**WGCRVAGRNWMREAENPAQWRTIGEAYVYQ 332 T LG+VE G + +W+ A+ P WRT+ A +Y+ Sbjct: 17 TKLGAVEVLIGAGLVCHSWLDAAKVPELWRTVDMAVLYR 55 >12_01_0541 + 4251931-4254141 Length = 736 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 369 AGFSASLIQFLPATLHPHHHSTEPKG 446 A S S + F PA LH HHH + P G Sbjct: 343 AALSLSTL-FSPALLHHHHHHSPPPG 367 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,611,939 Number of Sequences: 37544 Number of extensions: 245670 Number of successful extensions: 572 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -