BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0775 (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58) 31 1.2 SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58) 31 1.2 SB_23124| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 1.2 SB_23084| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 1.2 SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065) 31 1.2 SB_2120| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 1.2 SB_1327| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 1.2 SB_46852| Best HMM Match : AT_hook (HMM E-Value=2.6) 30 2.2 SB_45857| Best HMM Match : DUF1274 (HMM E-Value=2.4) 30 2.2 SB_43890| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_32772| Best HMM Match : AT_hook (HMM E-Value=2.6) 30 2.2 SB_59259| Best HMM Match : AT_hook (HMM E-Value=2.6) 30 2.2 SB_36149| Best HMM Match : AT_hook (HMM E-Value=2.6) 30 2.2 SB_11315| Best HMM Match : AT_hook (HMM E-Value=2.6) 30 2.2 SB_33808| Best HMM Match : Fibrinogen_C (HMM E-Value=0) 29 2.8 SB_21608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_55887| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_40565| Best HMM Match : DUF1274 (HMM E-Value=6.2) 29 3.8 SB_21106| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_54945| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_52811| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) 28 6.6 SB_47293| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4e-06) 28 6.6 SB_38360| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_37313| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_36139| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_21043| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_16201| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_13125| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_8476| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) 28 6.6 SB_58038| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_46411| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_45064| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_43639| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) 28 6.6 SB_30735| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0) 28 6.6 SB_24790| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_22656| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_12973| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_11676| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_10586| Best HMM Match : RVT_1 (HMM E-Value=0.039) 28 6.6 SB_9839| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 6.6 SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46) 28 6.6 SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 28 8.7 SB_4403| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 8.7 >SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 404 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G F R D+R K++L G R GRP R+ D Sbjct: 308 RWLGHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 346 >SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 359 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G F R D+R K++L G R GRP R+ D Sbjct: 308 RWLGHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 346 >SB_23124| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G F R D+R K++L G R GRP R+ D Sbjct: 107 RWLGHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 145 >SB_23084| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G F R D+R K++L G R GRP R+ D Sbjct: 153 RWLGHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 191 >SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065) Length = 435 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G F R D+R K++L G R GRP R+ D Sbjct: 339 RWLGHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 377 >SB_2120| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 235 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G F R D+R K++L G R GRP R+ D Sbjct: 185 RWLGHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 223 >SB_1327| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G F R D+R K++L G R GRP R+ D Sbjct: 107 RWLGHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 145 >SB_46852| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R AGRP R+ D Sbjct: 198 RWLGHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKD 236 >SB_45857| Best HMM Match : DUF1274 (HMM E-Value=2.4) Length = 288 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R AGRP R+ D Sbjct: 198 RWLGHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKD 236 >SB_43890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R AGRP R+ D Sbjct: 107 RWLGHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKD 145 >SB_32772| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 255 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R AGRP R+ D Sbjct: 159 RWLGHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKD 197 >SB_59259| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 203 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R AGRP R+ D Sbjct: 107 RWLGHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKD 145 >SB_36149| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R AGRP R+ D Sbjct: 198 RWLGHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKD 236 >SB_11315| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R AGRP R+ D Sbjct: 198 RWLGHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKD 236 >SB_33808| Best HMM Match : Fibrinogen_C (HMM E-Value=0) Length = 280 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARW 430 +W G R R K W P IGKR GRP W Sbjct: 201 KWLGHVLRMGQERIPKTSALWTP-IGKRKPGRPKTTW 236 >SB_21608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARW 430 +W G R R K W P IGKR GRP W Sbjct: 48 KWLGHVLRMGQERIPKTSALWTP-IGKRKPGRPKTTW 83 >SB_55887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R+ GRP R+ D Sbjct: 198 RWLGHLCRMDDDRVPKQLLFSELEQGSRAVGRPKLRFKD 236 >SB_40565| Best HMM Match : DUF1274 (HMM E-Value=6.2) Length = 294 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R+ GRP R+ D Sbjct: 198 RWLGHLCRMDDDRVPKQLLFSELEQGSRAVGRPKLRFKD 236 >SB_21106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 107 RWLGHLCRVDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 145 >SB_54945| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 392 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 310 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 348 >SB_52811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 58 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 96 >SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) Length = 1074 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 978 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 1016 >SB_47293| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4e-06) Length = 744 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 648 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 686 >SB_38360| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 387 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 291 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 329 >SB_37313| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 107 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 145 >SB_36139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 339 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 377 >SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 912 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 818 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPRLRFKD 856 >SB_21043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 146 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 184 >SB_16201| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 154 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 58 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 96 >SB_13125| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 154 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 58 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 96 >SB_8476| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 202 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 153 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 191 >SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 591 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 457 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 495 >SB_58038| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 201 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 105 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 143 >SB_46411| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 146 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 50 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 88 >SB_45064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 97 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 135 >SB_43639| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 153 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 191 >SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 675 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 579 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 617 >SB_30735| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 153 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 191 >SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 636 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 540 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 578 >SB_24790| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 226 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 130 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 168 >SB_22656| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 153 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 191 >SB_12973| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 153 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 191 >SB_11676| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 146 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 50 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 88 >SB_10586| Best HMM Match : RVT_1 (HMM E-Value=0.039) Length = 590 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 494 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 532 >SB_9839| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 127 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 31 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 69 >SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46) Length = 404 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 308 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 346 >SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 159 RWLGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 197 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D+R K++L G R GRP R+ D Sbjct: 745 RWFGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKD 783 >SB_4403| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -1 Query: 540 QWAGRFSRTTDNRWVKRVLEWRPRIGKRSAGRP*ARWSD 424 +W G R D R K++L G R GRP R+ D Sbjct: 198 RWLGHLCRMDDGRVPKQLLFSELEHGSRPVGRPKLRFKD 236 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,103,514 Number of Sequences: 59808 Number of extensions: 291664 Number of successful extensions: 688 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 688 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -