BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0772 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g39230.1 68417.m05553 isoflavone reductase, putative similar ... 29 2.2 At4g37030.1 68417.m05245 hypothetical protein 27 9.0 At1g14520.1 68414.m01721 oxygenase-related similar to myo-inosit... 27 9.0 >At4g39230.1 68417.m05553 isoflavone reductase, putative similar to allergenic isoflavone reductase-like protein Bet v 6.0102 [Betula pendula][GI:10764491]; contains Pfam profile PF02716: Isoflavone reductase Length = 308 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +3 Query: 468 KSSGVHYGVITCEGCKGFFRRSQSTVVNYQCPRNKACVVGQGQPQ 602 ++ G+ Y ++C G+F + + PR+K V+G G P+ Sbjct: 141 EAEGIPYTYVSCNFFAGYFLPTLAQPGATSAPRDKVIVLGDGNPK 185 >At4g37030.1 68417.m05245 hypothetical protein Length = 519 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -1 Query: 148 WLLFIVRNSIV*VSKETFLGYFRPVVVFRESNSHRGYALV 29 W + ++ +V + F+G + VVVF+E + RG + V Sbjct: 246 WPIVVIGFILVTIFSSIFVGLYGAVVVFQERSFRRGVSYV 285 >At1g14520.1 68414.m01721 oxygenase-related similar to myo-inositol oxygenase [Sus scrofa] gi|17432544|gb|AAL39076 Length = 311 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 442 ISIWALIELA-AFLSMNMPDIDEPKMPSLL 356 +SIW EL F+ + PD+DEP++ LL Sbjct: 95 MSIWECCELLNEFIDESDPDLDEPQIEHLL 124 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,316,397 Number of Sequences: 28952 Number of extensions: 327249 Number of successful extensions: 909 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 881 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 906 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -