BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0768 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13F5.04c |||endosomal sorting protein |Schizosaccharomyces p... 29 0.58 SPAC1F7.11c |||transcription factor zf-fungal binuclear cluster ... 28 1.0 SPBC29A10.08 |||1,3-beta-glucanosyltransferase |Schizosaccharomy... 26 4.1 SPCC1739.12 |ppe1|esp1, ppx1|serine/threonine protein phosphatas... 26 5.4 SPAC12B10.03 |||WD repeat protein, human WDR20 family|Schizosacc... 25 7.2 SPCP1E11.05c |||sterol O-acyltransferase |Schizosaccharomyces po... 25 7.2 >SPAC13F5.04c |||endosomal sorting protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 277 Score = 29.1 bits (62), Expect = 0.58 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = +1 Query: 400 PPAISAAPDLPTTESPASACGLIRFRSAKTKK*QTDSAARPPVRSPTLARSVVTLI-PKI 576 P S +LPT + S +S + QT RPP SPT + T I P + Sbjct: 138 PSTTSITENLPTIDPTRSTRSSSHIQSLSPESKQTSDGHRPP--SPTSITTTSTSIDPSV 195 Query: 577 AVNTTSVL 600 A ++ S L Sbjct: 196 AFSSKSTL 203 >SPAC1F7.11c |||transcription factor zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 1|||Manual Length = 782 Score = 28.3 bits (60), Expect = 1.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 6/48 (12%) Frame = +3 Query: 150 ISCDKYWKCDN----GVAELKTCGNGLAFDATDS--KYLTENCDYLHN 275 + CD+ W C+N G+ L C NG+ +D K L D L N Sbjct: 30 LKCDRVWPCENCKKRGIPNL--CPNGILVSVSDKLIKLLLSRIDTLQN 75 >SPBC29A10.08 |||1,3-beta-glucanosyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 459 Score = 26.2 bits (55), Expect = 4.1 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +3 Query: 174 CDNGVAELKTCGNGLAFDATDSKYLTENCDYLHNVEC 284 C N V LK NG + S+ L+E C Y N C Sbjct: 374 CSNAVKNLKCSANGTPSGSKISQVLSELC-YYDNKAC 409 >SPCC1739.12 |ppe1|esp1, ppx1|serine/threonine protein phosphatase Ppe1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 305 Score = 25.8 bits (54), Expect = 5.4 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = -1 Query: 575 IFGMSVTTERASVGDLT-GGRAAESV--CYFFVFALRNLIS 462 +FG VTTE + + DLT RA + V Y + FA +NL++ Sbjct: 213 LFGSKVTTEFSQINDLTLIARAHQLVQEGYKYHFADKNLVT 253 >SPAC12B10.03 |||WD repeat protein, human WDR20 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 543 Score = 25.4 bits (53), Expect = 7.2 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -3 Query: 276 RCEGSRSSRSS-IWNLWRRKRDRYRRFSVRLHR 181 RC+G +S + I++ WR D YR SV L R Sbjct: 401 RCQGHKSWVTDVIFDAWRCDDDNYRIASVGLDR 433 >SPCP1E11.05c |||sterol O-acyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 472 Score = 25.4 bits (53), Expect = 7.2 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 348 FPDENKCDVFWNCW 389 F D N D +WNCW Sbjct: 350 FADRNFYDDWWNCW 363 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,566,114 Number of Sequences: 5004 Number of extensions: 52422 Number of successful extensions: 188 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 188 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -