BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0765 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 6.4 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 6.4 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 6.4 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 21 8.5 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -1 Query: 541 SRCIFSTSIFVYCSIFSDNNLHFIFLIECRPLL 443 +R + S YC++FS + HF +++ PL+ Sbjct: 529 ARRVASVRAETYCNLFSLSVDHFNAVLDQYPLM 561 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -1 Query: 541 SRCIFSTSIFVYCSIFSDNNLHFIFLIECRPLL 443 +R + S YC++FS + HF +++ PL+ Sbjct: 497 ARRVASVRAETYCNLFSLSVDHFNAVLDQYPLM 529 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 114 LALASITA*CKTRGFTRTESGTKSVYSV 31 L LAS+ A + G T T +GT+ ++ + Sbjct: 167 LGLASVKAEPGSTGTTTTSTGTRLLHGI 194 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.4 bits (43), Expect = 8.5 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +2 Query: 266 KTEYLSKVPDPIALPFPESLYLQT---YVKMAKVQVLY 370 K + +SKVP P +LP + ++ + Y K+ K+ Y Sbjct: 46 KFKTVSKVPGPFSLPIFGTRWIFSCIGYYKLNKIHDAY 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,909 Number of Sequences: 438 Number of extensions: 4818 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -