BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0764 (450 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47179| Best HMM Match : Carboxyl_trans (HMM E-Value=0) 31 0.33 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_47111| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 1.3 SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 3.1 SB_59448| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57636| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48982| Best HMM Match : HEAT (HMM E-Value=0.78) 28 4.1 SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_27096| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 27 5.4 SB_52337| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 27 5.4 SB_24570| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_24169| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 27 5.4 SB_32284| Best HMM Match : FGGY_N (HMM E-Value=2.6e-07) 27 7.2 SB_34508| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_31574| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_6699| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) 27 9.5 >SB_47179| Best HMM Match : Carboxyl_trans (HMM E-Value=0) Length = 622 Score = 31.5 bits (68), Expect = 0.33 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 441 PTRQXGXGPAGYSGTPAAPXGRPDG 367 P +Q P GY G P+AP G P G Sbjct: 429 PPQQPSYPPGGYGGPPSAPYGAPPG 453 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 31.1 bits (67), Expect = 0.44 Identities = 19/54 (35%), Positives = 24/54 (44%) Frame = +1 Query: 250 GLPRSTLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVGPPXRCRWCPGIP 411 G P + P GA HPK P P +R+ S + P GPP + PG P Sbjct: 585 GTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRL-PPPGPPYQRVPPPGAP 637 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/54 (33%), Positives = 21/54 (38%) Frame = +1 Query: 250 GLPRSTLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVGPPXRCRWCPGIP 411 G P + P GA HP+ P P R+ S V P P R PG P Sbjct: 525 GAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVP-PPGAP 577 Score = 27.9 bits (59), Expect = 4.1 Identities = 17/54 (31%), Positives = 21/54 (38%) Frame = +1 Query: 250 GLPRSTLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVGPPXRCRWCPGIP 411 G P + P GA HP+ P P +R+ V P P R PG P Sbjct: 475 GAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVP-PPGAP 527 Score = 27.9 bits (59), Expect = 4.1 Identities = 19/61 (31%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +1 Query: 208 RAEPPTRSEPG*GR-GLPRSTLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVGPPX 384 R PP S P G P + P GA HP+ P P R+ V P P Sbjct: 550 RVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQ 609 Query: 385 R 387 R Sbjct: 610 R 610 Score = 27.1 bits (57), Expect = 7.2 Identities = 17/54 (31%), Positives = 20/54 (37%) Frame = +1 Query: 250 GLPRSTLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVGPPXRCRWCPGIP 411 G P + P GA HP+ P P R+ V P P R PG P Sbjct: 495 GAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP-PPGAP 547 Score = 26.6 bits (56), Expect = 9.5 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 1/69 (1%) Frame = +1 Query: 208 RAEPPTRSEPG*GR-GLPRSTLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVGPPX 384 R PP P G P P GA HP+ P P R+ V P P Sbjct: 420 RVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHP 479 Query: 385 RCRWCPGIP 411 R PG P Sbjct: 480 RVP-PPGAP 487 Score = 26.6 bits (56), Expect = 9.5 Identities = 17/54 (31%), Positives = 20/54 (37%) Frame = +1 Query: 250 GLPRSTLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVGPPXRCRWCPGIP 411 G P + P GA HP+ P P R+ V P P R PG P Sbjct: 445 GAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP-PPGAP 497 Score = 26.6 bits (56), Expect = 9.5 Identities = 17/54 (31%), Positives = 20/54 (37%) Frame = +1 Query: 250 GLPRSTLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVGPPXRCRWCPGIP 411 G P + P GA HP+ P P R+ V P P R PG P Sbjct: 455 GAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVP-PPGAP 507 Score = 26.6 bits (56), Expect = 9.5 Identities = 17/54 (31%), Positives = 20/54 (37%) Frame = +1 Query: 250 GLPRSTLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVGPPXRCRWCPGIP 411 G P + P GA HP+ P P R+ V P P R PG P Sbjct: 465 GAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVP-PPGAP 517 >SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 29.9 bits (64), Expect = 1.0 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 277 DGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVGPPXRCR 393 DG P +QPT+ I+ T + P GPP C+ Sbjct: 70 DGITSPNHTQPTQVLPTIQPPPTHPYRQQGPAGPPVTCQ 108 >SB_47111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.0 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = +1 Query: 211 AEPPTRSEPG*GRGLPRSTLRPDGAAHPKDSQPTEPSRRIEGS 339 A P TRS R P T + A HPK QP PS R GS Sbjct: 39 ATPSTRSYDSLQRRAPEGTTVCN-AEHPKARQPATPSTRRHGS 80 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 29.5 bits (63), Expect = 1.3 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 Query: 420 GPAGYSGTPAAPXGRPDGLPYRDGRR 343 G GY G PA P GR DG+P GR+ Sbjct: 1853 GWKGYPGNPAGPPGR-DGIPGPPGRQ 1877 >SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1449 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 259 RSTLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVGPP 381 R +L PD + S+P + +R++E E A + QP GPP Sbjct: 134 RKSLSPDSHHSRRKSKPRKLARQME--EDEAWNPEQPFGPP 172 >SB_59448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 262 STLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQP 369 S P AHP+ S PTEP++R+ A S R+P Sbjct: 57 SDTEPTHRAHPQ-SPPTEPTQRLPRDGHPAPSKRRP 91 >SB_57636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 27.9 bits (59), Expect = 4.1 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -1 Query: 417 PAGYSGTPAAPXGRPDGLPYRDGR 346 P G+SG PAAP PD L Y D + Sbjct: 264 PGGHSGAPAAPAIGPDSL-YGDNK 286 >SB_48982| Best HMM Match : HEAT (HMM E-Value=0.78) Length = 390 Score = 27.9 bits (59), Expect = 4.1 Identities = 21/54 (38%), Positives = 26/54 (48%) Frame = +1 Query: 214 EPPTRSEPG*GRGLPRSTLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVG 375 EP TR P L RS DG H D +PTE RRIE + ++R+ G Sbjct: 327 EPATRKNP-----LYRSIF--DGFDHI-DGKPTESERRIEALQAQLQALREMAG 372 >SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 13 F*ANYLSNLDNSTTDSHSDDIYPHDD 90 F +NY + +N+T + H DD HDD Sbjct: 106 FLSNYFAAQNNNTNNHHDDDQDDHDD 131 >SB_27096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 27.9 bits (59), Expect = 4.1 Identities = 21/54 (38%), Positives = 26/54 (48%) Frame = +1 Query: 214 EPPTRSEPG*GRGLPRSTLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVG 375 EP TR P L RS DG H D +PTE RRIE + ++R+ G Sbjct: 740 EPATRKNP-----LYRSIF--DGFDHI-DGKPTESERRIEALQAQLQALREMAG 785 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 27.5 bits (58), Expect = 5.4 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 441 PTRQXGXGPAGYSGTPAAPXGRPDGLPYRDG 349 P G G G G PA P G P+GLP +G Sbjct: 239 PGNPGGPGYQGNHGNPAGPQG-PNGLPGPNG 268 >SB_52337| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 591 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 417 PAGYSGTPAAPXGRPDGLPYRDGR 346 P G+SGTPAAP P+ Y D + Sbjct: 332 PGGHSGTPAAPAVGPESF-YSDNK 354 >SB_24570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 502 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 417 PAGYSGTPAAPXGRPDGLPYRDGR 346 P G+SG PAAP P+ L Y D + Sbjct: 210 PGGHSGAPAAPAVNPESL-YGDNK 232 >SB_24169| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 591 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 417 PAGYSGTPAAPXGRPDGLPYRDGR 346 P G+SGTPAAP P+ Y D + Sbjct: 332 PGGHSGTPAAPAVGPESF-YSDNK 354 >SB_32284| Best HMM Match : FGGY_N (HMM E-Value=2.6e-07) Length = 582 Score = 27.1 bits (57), Expect = 7.2 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +1 Query: 22 NYLSNLDNSTTD--SHSDDIYPHDDGFREDVLLEKLEGSITWSYCW 153 NY++N DN D DD+Y DDG D +K + SY W Sbjct: 259 NYINNYDNDNDDKPDEIDDVY-DDDGDDYDDYNDKCDDD---SYAW 300 >SB_34508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 27.1 bits (57), Expect = 7.2 Identities = 15/57 (26%), Positives = 22/57 (38%) Frame = +1 Query: 217 PPTRSEPG*GRGLPRSTLRPDGAAHPKDSQPTEPSRRIEGSETSAVSVRQPVGPPXR 387 PPT S PG ST P + ++ + P R E E+ +Q P + Sbjct: 76 PPTTSSPGNASSSGNSTTSPSNTRDGQVARNSVPFRTREARESEFTRAKQEAPQPIK 132 >SB_31574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 27.1 bits (57), Expect = 7.2 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 450 YRAPTRQXGXGPAGYSGTPAAPXGRPDGLPYRDGR 346 +R R+ P GYSG PA P P+ Y D + Sbjct: 257 WREAKRRFVRPPGGYSGAPAVPAVSPESF-YGDNK 290 >SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2162 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 371 TGCRTETADVSEPSIRLEGSVGWESLG*AAPSG 273 TGCR++ A P +R + S W + A P G Sbjct: 1644 TGCRSDDACAVRPCMRGQCSDDWNAFKCACPEG 1676 >SB_6699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1087 Score = 26.6 bits (56), Expect = 9.5 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = -2 Query: 371 TGCRTETADVSEPSIRLEGSVGWESLG*AAPSGRSVDRGSPLPHPGS 231 TGC VS PS + + + P+G + RGSPL P S Sbjct: 869 TGCDVSAIPVSTPSTVQSPTSRVQHVS-TTPNGVDMRRGSPLDSPSS 914 >SB_41173| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.8) Length = 405 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 271 RPDGAAHPKDSQPTEPSRRIEGSE 342 +P+G +P DSQ +EP+ + + SE Sbjct: 243 KPEGQENPVDSQLSEPAEQAQESE 266 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,733,756 Number of Sequences: 59808 Number of extensions: 310709 Number of successful extensions: 1127 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1121 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -