BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0763 (750 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC630.14c |tup12||transcriptional corepressor Tup12 |Schizosac... 32 0.10 SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pomb... 26 6.6 SPAC167.03c |snu66||U4/U6 x U5 tri-snRNP complex subunit Snu66 |... 25 8.7 SPAC1B1.01 |||transcription factor Rdp1|Schizosaccharomyces pomb... 25 8.7 >SPAC630.14c |tup12||transcriptional corepressor Tup12 |Schizosaccharomyces pombe|chr 1|||Manual Length = 586 Score = 31.9 bits (69), Expect = 0.10 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +1 Query: 331 VQELHRKGHEISVFSITHKDDPQYWTSGSYDD 426 V++LH GHE SV+S+ D +Y SGS D+ Sbjct: 451 VEQLH--GHEESVYSVAFSPDGKYLVSGSLDN 480 >SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 821 Score = 25.8 bits (54), Expect = 6.6 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +1 Query: 286 KGTFFVSHKYTNYAAVQELHRKGH-EISVFSITHKDDPQYWTSGSYDDWLAEM 441 + TFF++ KY++++ L K + V + KDD + + S D L+ + Sbjct: 201 ENTFFIARKYSDFSHFHHLLLKSYPNAYVPRLPPKDDHDTYLNSSEDSTLSPL 253 >SPAC167.03c |snu66||U4/U6 x U5 tri-snRNP complex subunit Snu66 |Schizosaccharomyces pombe|chr 1|||Manual Length = 649 Score = 25.4 bits (53), Expect = 8.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 31 KXESDENACTVELDPNRAPDCDPNQCVLPDCFCSAD 138 K +SD VELD + DP+ VLP+ ++D Sbjct: 295 KSKSDRRKRLVELDAENENENDPSDFVLPNGQSNSD 330 >SPAC1B1.01 |||transcription factor Rdp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 478 Score = 25.4 bits (53), Expect = 8.7 Identities = 9/38 (23%), Positives = 18/38 (47%) Frame = +1 Query: 70 DPNRAPDCDPNQCVLPDCFCSADGTRIPGGIEPNQVPQ 183 DP++ P+ +P+ A + G+ P +VP+ Sbjct: 260 DPSQVPESNPSAAAAVAAAAVAAAANLTNGVNPPEVPR 297 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,110,427 Number of Sequences: 5004 Number of extensions: 65909 Number of successful extensions: 165 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 165 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -