BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0760 (604 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 25 2.5 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 24 3.3 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 23 7.6 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 24.6 bits (51), Expect = 2.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 194 RGLRLGIFSETIFSRCMFL 250 R ++ G+F + IFS C FL Sbjct: 504 RAIKFGLFFQPIFSVCWFL 522 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 399 GLGPDRCILKDFLVLSLKCSFSILL 473 GLGP CI F ++ K F LL Sbjct: 469 GLGPRNCIGSRFALMETKAVFFFLL 493 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.0 bits (47), Expect = 7.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 384 SVIQNGLGPDRCILKDFLVLSLKCSFSILLM 476 S I G GP CI F +L + ++LLM Sbjct: 433 SFIPFGEGPRICIAARFGMLEARVGLAVLLM 463 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 590,098 Number of Sequences: 2352 Number of extensions: 10824 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -