BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0757 (500 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 28 0.16 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 5.8 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 28.3 bits (60), Expect = 0.16 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = -2 Query: 256 GASAACVYHYGLTKYKLRVFIILSLLXPLVTFSRPILLREWSSYTAHGSNHFV 98 G + + Y ++ Y L F+I++L ++ + L R+WS H + FV Sbjct: 1395 GCGSNIAFPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFV 1447 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 5.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 132 PLTPHTAQITLSHPTLFGPNS 70 PL PH + LS P + PN+ Sbjct: 418 PLNPHAGTVELSIPLIELPNA 438 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 436,891 Number of Sequences: 2352 Number of extensions: 8051 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -