BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0757 (500 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31360.1 68414.m03838 DNA helicase, putative (RECQl2) nearly ... 28 3.1 At2g27900.1 68415.m03382 expressed protein 27 7.1 >At1g31360.1 68414.m03838 DNA helicase, putative (RECQl2) nearly identical to DNA Helicase [Arabidopsis thaliana] GI:11121445 Length = 705 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = -2 Query: 148 LLREWSSYTAHGSNHFVTSNPIRTKLLTQKKTXSIKLYSTRS 23 +L+E +T + +N +VT P+ +LL +KT ++ S ++ Sbjct: 544 VLKEEFQHTPYSTNAYVTMGPLANQLLQGRKTIKMETSSRQT 585 >At2g27900.1 68415.m03382 expressed protein Length = 1124 Score = 27.1 bits (57), Expect = 7.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 128 LHRTRLKSLCHIQPYSDQTLNSK 60 LHRT + L H+ Y D+ NSK Sbjct: 946 LHRTTARILLHVNGYVDRIANSK 968 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,743,169 Number of Sequences: 28952 Number of extensions: 151656 Number of successful extensions: 242 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 242 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -