BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0754 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 25 0.76 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 25 0.76 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 24 1.3 AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding prote... 24 1.8 AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding prote... 24 1.8 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 3.1 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 22 7.1 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 22 7.1 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 22 7.1 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 9.3 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 25.0 bits (52), Expect = 0.76 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = -3 Query: 316 CQLSSASQACFSEELLFVHHRGSSCHHLTTLHPCPIPRHQYCTLWQNVKTSLG 158 C L AS +++L+F+ G + LH ++ T + N KT+ G Sbjct: 174 CSLRMASYGWTTDDLVFLWKEGDPVQVVKNLHLPRFTLEKFFTDYCNSKTNTG 226 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 25.0 bits (52), Expect = 0.76 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = -3 Query: 316 CQLSSASQACFSEELLFVHHRGSSCHHLTTLHPCPIPRHQYCTLWQNVKTSLG 158 C L AS +++L+F+ G + LH ++ T + N KT+ G Sbjct: 174 CSLRMASYGWTTDDLVFLWKEGDPVQVVKNLHLPRFTLEKFFTDYCNSKTNTG 226 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +1 Query: 355 VMFLGNLDEIVKKFKSFPDTRVLFSAEQFC 444 +M + D +VK FK+F D + L+ + C Sbjct: 419 IMGEADCDFVVKLFKTFKDRKYLYMLMEAC 448 >AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 23.8 bits (49), Expect = 1.8 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +1 Query: 526 YLPEIYEIINSNPIKDKDDDQLYYTKIYLDKDLRESLKITLDHKSEIFQN 675 + +++EII K D+D+ + Y+D L E +K D +I N Sbjct: 88 FTEDVHEIIEQCVSKAADEDECMVARKYIDCAL-EKMKFLDDELEKIAGN 136 >AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 23.8 bits (49), Expect = 1.8 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +1 Query: 526 YLPEIYEIINSNPIKDKDDDQLYYTKIYLDKDLRESLKITLDHKSEIFQN 675 + +++EII K D+D+ + Y+D L E +K D +I N Sbjct: 88 FTEDVHEIIEQCVSKAADEDECMVARKYIDCAL-EKMKFLDDELEKIAGN 136 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 423 FFC*TILLA*CKTCNS 470 FFC I+ + CKTC S Sbjct: 288 FFCVNIVTSYCKTCIS 303 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 176 VLPKCTILMSRYWA 217 +L C I + RYWA Sbjct: 124 ILNLCAIALDRYWA 137 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 176 VLPKCTILMSRYWA 217 +L C I + RYWA Sbjct: 124 ILNLCAIALDRYWA 137 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 176 VLPKCTILMSRYWA 217 +L C I + RYWA Sbjct: 124 ILNLCAIALDRYWA 137 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 176 VLPKCTILMSRYWA 217 +L C I + RYWA Sbjct: 134 ILNLCVISLDRYWA 147 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,277 Number of Sequences: 438 Number of extensions: 4748 Number of successful extensions: 16 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -