BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0753 (450 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 25 1.6 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 25 1.6 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 25 1.6 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 25 1.6 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 25 1.6 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 25 1.6 AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 24 2.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 3.8 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 23 5.0 AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine p... 23 6.6 AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homoc... 23 6.6 AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 22 8.7 AF203334-1|AAF19829.1| 110|Anopheles gambiae immune-responsive ... 22 8.7 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 24.6 bits (51), Expect = 1.6 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 311 ATNFSECSGTTRSSWSADSISVAGYSGRFSLGG 213 +T ++ G +RSS++ S A Y G +GG Sbjct: 4 STEYAPTDGMSRSSYTRSSYRSAYYGGPPEIGG 36 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.6 bits (51), Expect = 1.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 Query: 398 PPPCPALVSNLASSGARCAGE 336 PPPCP ++ CAG+ Sbjct: 141 PPPCPPTLTTFNGGQPTCAGK 161 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.6 bits (51), Expect = 1.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 Query: 398 PPPCPALVSNLASSGARCAGE 336 PPPCP ++ CAG+ Sbjct: 141 PPPCPPTLTTFNGGQPTCAGK 161 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.6 bits (51), Expect = 1.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 Query: 398 PPPCPALVSNLASSGARCAGE 336 PPPCP ++ CAG+ Sbjct: 141 PPPCPPTLTTFNGGQPTCAGK 161 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 24.6 bits (51), Expect = 1.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 Query: 398 PPPCPALVSNLASSGARCAGE 336 PPPCP ++ CAG+ Sbjct: 139 PPPCPPTLTTFNGGQPTCAGK 159 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.6 bits (51), Expect = 1.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 Query: 398 PPPCPALVSNLASSGARCAGE 336 PPPCP ++ CAG+ Sbjct: 141 PPPCPPTLTTFNGGQPTCAGK 161 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 24.2 bits (50), Expect = 2.2 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 277 RVVPLHSLKFVAELQHVAGRSPAQ 348 RV+ L+S+ FVA LQ V + PA+ Sbjct: 76 RVLVLNSIGFVAHLQTVRLQRPAE 99 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 3.8 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 359 SGARCAGERPATCCSSATNFSECSGTTRS 273 S RC G +P CC C+G T+S Sbjct: 189 SQGRCFGPKPRECCHLFC-AGGCTGPTQS 216 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 23.0 bits (47), Expect = 5.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 171 VRILAEVLALTQHSAAERESARVPGDA 251 +R L++ Q +RE+ R PGDA Sbjct: 602 LRCLSDHSVFVQSYYLDREAGRTPGDA 628 >AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 22.6 bits (46), Expect = 6.6 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = -2 Query: 374 SNLASSGARCAGERPATCCSSATNFSECSGT----TRSSW 267 +++A++G+ G T + ATN S +GT RS W Sbjct: 50 NSVANAGSNGTGNNVITATNGATNGSLPNGTAVKENRSKW 89 >AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homocysteine hydrolase protein. Length = 432 Score = 22.6 bits (46), Expect = 6.6 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 226 NRPEYPATL-ILSADHDDRVVPLHSLKFVAELQHVAGRSP 342 NR +Y + +L DD V LH K +L ++ R P Sbjct: 375 NREQYAIGVHVLPKKLDDEVAALHLDKLGVKLTKLSARQP 414 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 22.2 bits (45), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 401 FPPPCPALVSNLASSGA 351 FPPPC L++SGA Sbjct: 48 FPPPCRVPGWRLSTSGA 64 >AF203334-1|AAF19829.1| 110|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR5 protein. Length = 110 Score = 22.2 bits (45), Expect = 8.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 377 VSNLASSGARCAGERPA 327 V + S+GA+CA RPA Sbjct: 80 VVGIYSNGAQCAQHRPA 96 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 371,269 Number of Sequences: 2352 Number of extensions: 7453 Number of successful extensions: 25 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38268990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -