BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0744 (450 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57460| Best HMM Match : Folate_rec (HMM E-Value=0.03) 29 1.3 SB_54161| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_57460| Best HMM Match : Folate_rec (HMM E-Value=0.03) Length = 190 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 239 WCRCRSCCRYLPVSSPFRG 183 W R RSCCR+ V+S F+G Sbjct: 53 WFRERSCCRHTEVTSVFKG 71 >SB_54161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 124 TWSAGRVTSTRSLRMILLKHSKQHTITHVPSYTTYT 17 TWS G VT SL I++ + HV + T YT Sbjct: 56 TWSLGVVTGVFSLLFIVVPRKGRCDQLHVNNATAYT 91 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,137,998 Number of Sequences: 59808 Number of extensions: 159995 Number of successful extensions: 451 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 451 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -