BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0744 (450 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 27 0.31 AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 24 2.8 AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside ... 23 6.6 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 27.1 bits (57), Expect = 0.31 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 82 MILLKHSKQHTITHVPSYTTYTARADA 2 +IL H K HTI+ + +TTY A Sbjct: 362 IILKSHVKSHTISELSPFTTYFVNVSA 388 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 23.8 bits (49), Expect = 2.8 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -1 Query: 360 HNXASLPLELXVFVSELIGSFLISGCTS---ENFFSKXSA 250 +N AS+P L + E++G F SG + ENF + SA Sbjct: 70 YNIASMPTFLFIKRKEVVGQF--SGANAEKLENFIQQHSA 107 >AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside phosphorylase protein. Length = 353 Score = 22.6 bits (46), Expect = 6.6 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 102 VTLPADHVSALHYAGRCGRTGPSRVRRSPKW 194 + L DH++ + +AG GP+ R P++ Sbjct: 194 IMLIKDHINLMGFAGNNPLQGPNDERFGPRF 224 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 367,617 Number of Sequences: 2352 Number of extensions: 4635 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38268990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -