BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0744 (450 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK095783-1|BAC04626.1| 215|Homo sapiens protein ( Homo sapiens ... 33 0.60 D50487-1|BAA09078.1| 1220|Homo sapiens RNA helicase protein. 29 9.7 BC047327-1|AAH47327.2| 1220|Homo sapiens DEAH (Asp-Glu-Ala-His) ... 29 9.7 BC044586-1|AAH44586.2| 1220|Homo sapiens DEAH (Asp-Glu-Ala-His) ... 29 9.7 >AK095783-1|BAC04626.1| 215|Homo sapiens protein ( Homo sapiens cDNA FLJ38464 fis, clone FEBRA2021171. ). Length = 215 Score = 32.7 bits (71), Expect = 0.60 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -2 Query: 269 SSVNXRQAIPWCRCRSCCRYLPVSSPFRGSSDPRWA 162 SSV R+A P CRC S C P P SS WA Sbjct: 23 SSVKWRRACP-CRCHSHCWRWPYLQPVPASSSSSWA 57 >D50487-1|BAA09078.1| 1220|Homo sapiens RNA helicase protein. Length = 1220 Score = 28.7 bits (61), Expect = 9.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 99 LVTLPADHVSALHYAGRCGRTGPSRVRR 182 LV P A AGR GRTGP + R Sbjct: 874 LVVTPISQAQAKQRAGRAGRTGPGKCYR 901 >BC047327-1|AAH47327.2| 1220|Homo sapiens DEAH (Asp-Glu-Ala-His) box polypeptide 8 protein. Length = 1220 Score = 28.7 bits (61), Expect = 9.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 99 LVTLPADHVSALHYAGRCGRTGPSRVRR 182 LV P A AGR GRTGP + R Sbjct: 874 LVVTPISQAQAKQRAGRAGRTGPGKCYR 901 >BC044586-1|AAH44586.2| 1220|Homo sapiens DEAH (Asp-Glu-Ala-His) box polypeptide 8 protein. Length = 1220 Score = 28.7 bits (61), Expect = 9.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 99 LVTLPADHVSALHYAGRCGRTGPSRVRR 182 LV P A AGR GRTGP + R Sbjct: 874 LVVTPISQAQAKQRAGRAGRTGPGKCYR 901 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,638,740 Number of Sequences: 237096 Number of extensions: 720602 Number of successful extensions: 1674 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1674 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3701294870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -