BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0744 (450 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 2.7 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 2.7 AF213011-1|AAG43567.1| 62|Apis mellifera esterase A2 protein. 21 8.2 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/39 (28%), Positives = 16/39 (41%) Frame = -3 Query: 418 PGFKWIRLERLEFADGLSAA*XCLITARVXSVCIGANRF 302 P W+ + L+ + L L A +CIG RF Sbjct: 307 PSNSWVAINELQDSFWLEQYSWALFKAMSHMLCIGYGRF 345 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/39 (28%), Positives = 16/39 (41%) Frame = -3 Query: 418 PGFKWIRLERLEFADGLSAA*XCLITARVXSVCIGANRF 302 P W+ + L+ + L L A +CIG RF Sbjct: 275 PSNSWVAINELQDSFWLEQYSWALFKAMSHMLCIGYGRF 313 >AF213011-1|AAG43567.1| 62|Apis mellifera esterase A2 protein. Length = 62 Score = 20.6 bits (41), Expect = 8.2 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = -2 Query: 74 VEALETTYDHTRPVLHYVH 18 ++ + D ++PV+ YVH Sbjct: 7 LDVYTNSLDQSKPVMFYVH 25 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,757 Number of Sequences: 438 Number of extensions: 1322 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -