BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0741 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 93 3e-21 AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 22 4.5 AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 21 7.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.8 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 92.7 bits (220), Expect = 3e-21 Identities = 50/93 (53%), Positives = 61/93 (65%), Gaps = 1/93 (1%) Frame = +3 Query: 279 YRKLDSPTDSGIESGNEKHEXXXXXXXXXXXXXXXLEEHTEDRRPTAPADDMPVLKRVLQ 458 +RKLDSP+DSGIESG EK + +ED+ +DMPVLKRVLQ Sbjct: 571 FRKLDSPSDSGIESGTEKPDKPASSSASSAPTSVCSSPRSEDKE----VEDMPVLKRVLQ 626 Query: 459 APPLYGGTSTLMDETYKPHKKFRAMR-RDTGEA 554 APPLY T++LMDE YKPHKKFRA+R +D+ EA Sbjct: 627 APPLY-DTNSLMDEAYKPHKKFRALRQKDSAEA 658 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +3 Query: 513 HKKFRAMRRDTG 548 +KK+RA+R DTG Sbjct: 52 NKKYRALRLDTG 63 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 130 RVTVALLYWQQRW 168 RVT +L WQ +W Sbjct: 61 RVTCDVLSWQSKW 73 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 106 DTDPMGLRADSSTTESAQETPSS 38 D P+ ++DSS++ + E+P S Sbjct: 439 DQPPLSPQSDSSSSSRSAESPMS 461 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,339 Number of Sequences: 438 Number of extensions: 2963 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -