BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0739 (350 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36388| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-08 SB_36385| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-08 SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-06 SB_40653| Best HMM Match : ABC_tran (HMM E-Value=0) 46 7e-06 SB_45078| Best HMM Match : ABC_tran (HMM E-Value=2.6e-36) 40 8e-04 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 40 8e-04 SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.007 SB_59051| Best HMM Match : ABC_tran (HMM E-Value=2.4e-41) 36 0.009 SB_40695| Best HMM Match : ABC_tran (HMM E-Value=7.79963e-42) 36 0.012 SB_11108| Best HMM Match : ABC_tran (HMM E-Value=0) 35 0.016 SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0) 34 0.037 SB_29759| Best HMM Match : ABC_tran (HMM E-Value=0) 33 0.086 SB_42542| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.086 SB_17925| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.20 SB_1653| Best HMM Match : ABC_tran (HMM E-Value=0) 31 0.20 SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.20 SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_38073| Best HMM Match : ABC_tran (HMM E-Value=1.2e-17) 30 0.46 SB_42212| Best HMM Match : ABC_tran (HMM E-Value=0) 30 0.61 SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.80 SB_28063| Best HMM Match : ABC_tran (HMM E-Value=0) 29 0.80 SB_35301| Best HMM Match : ABC_tran (HMM E-Value=0) 29 1.1 SB_49365| Best HMM Match : ABC_tran (HMM E-Value=3.5e-38) 28 1.9 SB_53871| Best HMM Match : ABC_tran (HMM E-Value=1.49939e-42) 28 2.4 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 27 5.7 SB_59679| Best HMM Match : Lectin_C (HMM E-Value=5.3e-10) 27 5.7 SB_30509| Best HMM Match : TSP_1 (HMM E-Value=0.00019) 26 7.5 SB_17496| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 >SB_36388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1570 Score = 54.4 bits (125), Expect = 2e-08 Identities = 21/36 (58%), Positives = 28/36 (77%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEVA 345 +PF+AYSDE++W LE +HL+AF GLP GL H +A Sbjct: 1428 DPFDAYSDEDLWEVLEVSHLKAFASGLPEGLLHPIA 1463 >SB_36385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 54.4 bits (125), Expect = 2e-08 Identities = 21/36 (58%), Positives = 28/36 (77%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEVA 345 +PF+AYSDE++W LE +HL+AF GLP GL H +A Sbjct: 997 DPFDAYSDEDLWEVLEVSHLKAFASGLPEGLLHPIA 1032 >SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1716 Score = 48.8 bits (111), Expect = 1e-06 Identities = 19/35 (54%), Positives = 27/35 (77%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +PFE ++D+E+W A+EHA L+A V GLP L +EV Sbjct: 1266 DPFEKFTDDELWEAIEHASLKALVAGLPGKLYYEV 1300 >SB_40653| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 672 Score = 46.4 bits (105), Expect = 7e-06 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +PFE+ DEE+WR LE HL++FV L GL H++ Sbjct: 517 DPFESTCDEELWRVLEAVHLKSFVSSLQDGLMHQI 551 >SB_45078| Best HMM Match : ABC_tran (HMM E-Value=2.6e-36) Length = 972 Score = 39.5 bits (88), Expect = 8e-04 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEVA 345 +PF +SD+ +W LE HLR V LP G+ E+A Sbjct: 898 DPFAQFSDDALWNGLEEVHLRETVDKLPDGIETELA 933 >SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) Length = 435 Score = 39.5 bits (88), Expect = 8e-04 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEVA 345 +PF +SD+ +W LE HLR V LP G+ E+A Sbjct: 14 DPFAQFSDDALWNGLEEVHLRETVDKLPDGIETELA 49 >SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1250 Score = 36.3 bits (80), Expect = 0.007 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGL 330 +PF+ Y+DEEIW ALE A L+ + +P L Sbjct: 1105 DPFDKYADEEIWDALEGASLKRTILQMPGQL 1135 >SB_59051| Best HMM Match : ABC_tran (HMM E-Value=2.4e-41) Length = 474 Score = 35.9 bits (79), Expect = 0.009 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEVA 345 +PF +D+E+W AL+ HL+ +V LP L ++A Sbjct: 161 DPFSKRTDKEVWEALDKVHLKPWVETLPKQLYQDLA 196 >SB_40695| Best HMM Match : ABC_tran (HMM E-Value=7.79963e-42) Length = 355 Score = 35.5 bits (78), Expect = 0.012 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +PF+ Y+D+EIW AL A + V GL L++ + Sbjct: 214 DPFDIYTDDEIWSALHDAKVGPLVSGLVGKLKYHI 248 >SB_11108| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1266 Score = 35.1 bits (77), Expect = 0.016 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +PF +SD+EIW AL + ++ V LP L + + Sbjct: 1120 DPFRCFSDQEIWTALNNVQMKKCVESLPGKLEYRL 1154 >SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1310 Score = 33.9 bits (74), Expect = 0.037 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +PF+ ++D+EIW ALE L V LP L +++ Sbjct: 1163 DPFDKFTDQEIWAALESVQLLNTVRALPDQLMYQL 1197 >SB_29759| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1308 Score = 32.7 bits (71), Expect = 0.086 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +PF +SD EIW AL ++ L FV L L +V Sbjct: 1142 DPFGMFSDAEIWNALHNSQLGTFVGNLNGKLDFQV 1176 >SB_42542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 32.7 bits (71), Expect = 0.086 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +P Y D+EIW L+ L +FV LP L ++V Sbjct: 483 DPDHRYEDQEIWTVLKEVQLVSFVQRLPDALYYQV 517 >SB_17925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1075 Score = 31.5 bits (68), Expect = 0.20 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +PF ++D+EIW A+E L V LP L +++ Sbjct: 928 DPFGKFTDQEIWSAIESVQLLNTVRALPDQLMYQL 962 >SB_1653| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1702 Score = 31.5 bits (68), Expect = 0.20 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +P + Y+D+E+W AL A L + V L L + + Sbjct: 1561 DPLDMYTDDEVWIALHDAQLGSLVTSLDGKLEYHI 1595 >SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1315 Score = 31.5 bits (68), Expect = 0.20 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +PF+ + D+EIW ALE+ ++ + L L + + Sbjct: 1170 DPFDQFKDQEIWTALENVKMKHCIENLTGKLEYHL 1204 >SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 30.7 bits (66), Expect = 0.35 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 259 DEEIWRALEHAHLRAFVXGLPAGLRHEVA 345 D+E+WR LE LR V LP GL V+ Sbjct: 880 DDELWRVLEIVQLRERVESLPDGLGFRVS 908 >SB_38073| Best HMM Match : ABC_tran (HMM E-Value=1.2e-17) Length = 398 Score = 30.3 bits (65), Expect = 0.46 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +P Y DEE+W AL+ L V P GL +V Sbjct: 228 DPVSQYKDEELWTALKEVQLGDAVLEFPDGLDTKV 262 >SB_42212| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 301 Score = 29.9 bits (64), Expect = 0.61 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +P A++D+E+W AL + L V LP L + + Sbjct: 156 DPVNAFNDQELWTALRNVQLAGCVSCLPGKLDYRL 190 >SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 29.5 bits (63), Expect = 0.80 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEVA 345 +PF Y D +W LE ++ V LP L E++ Sbjct: 327 DPFSRYDDAALWNVLEQVEMKDKVKELPGELYFELS 362 >SB_28063| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1238 Score = 29.5 bits (63), Expect = 0.80 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +P + ++++E+W ALE+ + V LP L + + Sbjct: 1090 DPMQQFTNQEVWTALENVQMMKCVKRLPGKLEYRL 1124 >SB_35301| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 618 Score = 29.1 bits (62), Expect = 1.1 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEVA 345 +PF + D +W+ L+ L+ V LP L E+A Sbjct: 130 DPFSEHPDAGLWKVLDEVQLKQPVEDLPGKLDEELA 165 >SB_49365| Best HMM Match : ABC_tran (HMM E-Value=3.5e-38) Length = 283 Score = 28.3 bits (60), Expect = 1.9 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +P + Y+D+EIW AL +L + L H + Sbjct: 149 DPLDMYTDDEIWSALSDVNLSPVMDKWAYDLEHRI 183 >SB_53871| Best HMM Match : ABC_tran (HMM E-Value=1.49939e-42) Length = 347 Score = 27.9 bits (59), Expect = 2.4 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEV 342 +P + Y+D+EIW AL +L + L H + Sbjct: 206 DPLDMYTDDEIWSALSDVNLSPVMDKWGYDLEHRI 240 >SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1321 Score = 26.6 bits (56), Expect = 5.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 238 NPFEAYSDEEIWRALEHA 291 +PF +SD+ +W ALE A Sbjct: 851 DPFTQFSDDALWNALEEA 868 >SB_59679| Best HMM Match : Lectin_C (HMM E-Value=5.3e-10) Length = 849 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 26 TYSSENDPGSCGTRGCGN 79 TY S D G CG+ GCGN Sbjct: 707 TYGSSYDTG-CGSTGCGN 723 >SB_30509| Best HMM Match : TSP_1 (HMM E-Value=0.00019) Length = 448 Score = 26.2 bits (55), Expect = 7.5 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 Query: 262 RRCTPRTGSIPERINC*WVDTRI*PATNHLLIKLI 158 + CTP+ G IP I DT+ P ++ + I+LI Sbjct: 85 QECTPKNGGIPYLITTCSGDTKGSPTSSTVYIQLI 119 >SB_17496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 25.8 bits (54), Expect = 9.9 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 232 ESNPFEAYSDEEIWRALEHAHLRAFVXGLPAGLRHEVA 345 E+ E Y E+ W AL H ++ + G A HEVA Sbjct: 294 ENRNCEDYITEKYWEALNHENIPIVLGG--ANYDHEVA 329 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,522,703 Number of Sequences: 59808 Number of extensions: 172714 Number of successful extensions: 394 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 394 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 535585339 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -