BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0734 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosacc... 26 4.1 SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2... 26 4.1 SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces... 26 5.4 SPAC1687.04 |||conserved eukaryotic protein|Schizosaccharomyces ... 26 5.4 SPCC1393.08 |||transcription factor, zf-GATA type |Schizosacchar... 25 7.2 SPBC336.10c |tif512||translation initiation factor|Schizosacchar... 25 9.5 SPAC26H5.10c |tif51||translation initiation factor eIF5A|Schizos... 25 9.5 >SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 425 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 18 EPKPTSPARGAPCRSTNEALARR 86 EP P S A +P + + EALA R Sbjct: 64 EPSPASSASASPVKKSAEALAER 86 >SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 474 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 289 KALGVDFILIVIICVNVSPKYGSDTLINL 375 K LG+DF + +++C +YGS+ L +L Sbjct: 147 KELGIDFPVNLLMCFEGMEEYGSEGLEDL 175 >SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces pombe|chr 2|||Manual Length = 857 Score = 25.8 bits (54), Expect = 5.4 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -3 Query: 627 NGIGVFDVSSIKSYTFNLNLTYSYELSNESPHQNPRLSW 511 + I +FD++S N L+ S+E N+ Q+ ++W Sbjct: 744 SAIEIFDINSATEMPINEPLSASFESVNKENSQSGYMAW 782 >SPAC1687.04 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 501 Score = 25.8 bits (54), Expect = 5.4 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -3 Query: 633 TANGIGVFDVSSIKSYTFNLNLTYSYELSNESPHQNPRL 517 T N +G +V + S +LT+ Y S+ + H N R+ Sbjct: 348 TLNDVGCRNVQFLSSLISQQDLTFFYPFSSFTVHSNVRI 386 >SPCC1393.08 |||transcription factor, zf-GATA type |Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 48 APCRSTNEALARRGRHGTTV 107 A C ST +L R+ RHG TV Sbjct: 420 ANCSSTKTSLWRKDRHGQTV 439 >SPBC336.10c |tif512||translation initiation factor|Schizosaccharomyces pombe|chr 2|||Manual Length = 157 Score = 25.0 bits (52), Expect = 9.5 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +3 Query: 42 RGAPCRSTNEALARRGRHGTTVAYIV 119 +G PC+ + + ++ G+HG +IV Sbjct: 36 KGRPCKIVDMSTSKTGKHGHAKVHIV 61 >SPAC26H5.10c |tif51||translation initiation factor eIF5A|Schizosaccharomyces pombe|chr 1|||Manual Length = 157 Score = 25.0 bits (52), Expect = 9.5 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +3 Query: 42 RGAPCRSTNEALARRGRHGTTVAYIV 119 +G PC+ + + ++ G+HG +IV Sbjct: 36 KGRPCKIVDMSTSKTGKHGHAKVHIV 61 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,402,414 Number of Sequences: 5004 Number of extensions: 44854 Number of successful extensions: 101 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -