BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0731 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 26 0.37 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 8.0 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 25.8 bits (54), Expect = 0.37 Identities = 10/33 (30%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -1 Query: 309 QTKCTPLAYDLRFDLCMTGKVPSYSC-GQAASH 214 + + TP+ + L++ C+ +PS++C G+ AS+ Sbjct: 40 ECQVTPVIHVLQYPGCVPKPIPSFACIGRCASY 72 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -1 Query: 246 PSYSCGQAASHSCSGCARHH 187 P + + A++ C G RHH Sbjct: 54 PLHIPAKRAAYDCEGVIRHH 73 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,268 Number of Sequences: 336 Number of extensions: 2642 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -