SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0729
         (700 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC22E12.19 ||SPAC2E12.01|histone deacetylase complex subunit |...    27   2.6  

>SPAC22E12.19 ||SPAC2E12.01|histone deacetylase complex subunit
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 661

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = -3

Query: 686 RTVRSRXLTVPATKSRRRRRKSLAESFAGRSEAYK 582
           RT   R L   ATK++ RRRK L  S  G  +  K
Sbjct: 294 RTTDYRALVASATKTKGRRRKKLLPSQRGGKKKSK 328


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,221,217
Number of Sequences: 5004
Number of extensions: 37076
Number of successful extensions: 77
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 77
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 77
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 323158234
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -