BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0729 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 24 5.3 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 23 9.2 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 23.8 bits (49), Expect = 5.3 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = -3 Query: 650 TKSRRRRRKSLAESFAGRSEAYKPPHSIILM 558 TKS++RR ++ + Y+ H ++L+ Sbjct: 20 TKSQKRRSDAITRQLQKDKQVYRATHRLLLL 50 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 275 NLNLGQINSQKKRYEIFKKNIEKK 346 N+N G IN +KK+ K+N +K Sbjct: 92 NINEGSINKRKKKKSKKKQNKPRK 115 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 568,539 Number of Sequences: 2352 Number of extensions: 9964 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -