BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0729 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36880.1 68417.m05229 cysteine proteinase, putative strong si... 29 3.0 At5g40120.1 68418.m04867 MADS-box family protein identical to cD... 28 5.2 At1g23400.1 68414.m02930 expressed protein 27 9.0 >At4g36880.1 68417.m05229 cysteine proteinase, putative strong similarity to cysteine proteinase COT44 precursor SP:P25251 from [Brassica napus] (Rape) Length = 376 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 260 YDQTINLNLGQINSQKKRYEIFKKNI 337 + +T N N G IN Q KR+ IFK N+ Sbjct: 56 HGKTNNNNNGIINDQDKRFNIFKDNL 81 >At5g40120.1 68418.m04867 MADS-box family protein identical to cDNA GI:32402407 MADS-box protein AGL76 Length = 385 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +2 Query: 242 LKKKDSYDQTINLNLGQINSQKKRYEIFKKNIEKKSLSVSRFIVREII 385 L K+D YDQ N+ +G I + + F K E SV+ F + +++ Sbjct: 222 LMKQDGYDQNQNMRMGDITNNNFQLPYFSKK-EAVQESVNYFGMNQLM 268 >At1g23400.1 68414.m02930 expressed protein Length = 564 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 484 SDYNPKRPSVRPALSLPY 431 +D NPK+P PAL LP+ Sbjct: 56 TDTNPKKPQSNPALKLPH 73 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,516,206 Number of Sequences: 28952 Number of extensions: 191919 Number of successful extensions: 531 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 530 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -