BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0727 (750 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC736.07c |||cell polarity protein |Schizosaccharomyces pombe|... 28 1.2 SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe... 26 6.6 >SPCC736.07c |||cell polarity protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 699 Score = 28.3 bits (60), Expect = 1.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -2 Query: 341 IRHCASLSRIMLCNWKTPMELSNYLHSLIDNYN 243 IR+C ++ C + ++ N++H L+ NYN Sbjct: 30 IRYCKEDGKVEGCETASHVDFLNHIHLLLGNYN 62 >SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 721 Score = 25.8 bits (54), Expect = 6.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 541 KNTCQFSVTESVSIASITREQY 606 K ++SVTE A +TRE+Y Sbjct: 682 KGASEWSVTEKFKAAKVTREEY 703 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,495,924 Number of Sequences: 5004 Number of extensions: 43992 Number of successful extensions: 104 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -