BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0727 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0330 - 16816497-16819952 29 3.9 01_07_0320 + 42708082-42708324,42708359-42708409,42708987-427091... 28 9.1 >10_08_0330 - 16816497-16819952 Length = 1151 Score = 29.1 bits (62), Expect = 3.9 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 684 SALCGIMLNVECSNYSNSKHNR 619 S LCG+ LN+ C+NY+ + R Sbjct: 1060 SGLCGLPLNISCTNYALASDER 1081 >01_07_0320 + 42708082-42708324,42708359-42708409,42708987-42709122, 42709226-42709275,42709978-42710066,42710398-42710434, 42710435-42710471,42710588-42710733,42711099-42711241, 42711735-42711768,42711962-42712064,42712236-42712381, 42712982-42713323,42713416-42713656,42713733-42713788, 42713852-42713920 Length = 640 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -2 Query: 329 ASLSRIMLCNWKTPMELSNYLHSLIDNYNL 240 A L RI+ W TP ++ L LI NYNL Sbjct: 557 APLLRILRLEWITPWMTNDDLAVLIQNYNL 586 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,119,639 Number of Sequences: 37544 Number of extensions: 224320 Number of successful extensions: 453 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -