BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0727 (750 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99283-1|CAB16536.2| 414|Caenorhabditis elegans Hypothetical pr... 28 6.2 U42844-4|ABM01868.1| 739|Caenorhabditis elegans Hypothetical pr... 28 8.1 >Z99283-1|CAB16536.2| 414|Caenorhabditis elegans Hypothetical protein Y70C5C.2 protein. Length = 414 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 227 YNKMLNCNCLLTNVDSCSVPLEFSNY 304 YN + +CN LLT + S +V L+F+ + Sbjct: 321 YNNITSCNYLLTTLGSYNVMLKFNKF 346 >U42844-4|ABM01868.1| 739|Caenorhabditis elegans Hypothetical protein C08A9.3 protein. Length = 739 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +2 Query: 80 VGRYELLNFKLIWCVLLCRV-CYFFCFFFKQLVKLFRLKFCVVKFLPDYFYNKMLNCNCL 256 +GR ++ + + + V CR F F+K L + F +++ L Y N ML N L Sbjct: 623 LGRGQIGIYLVYYAVQKCRFERQSFTLFYKICCTLIFIVFMLMECLNRYLANFMLTYNVL 682 Query: 257 LTNVDS 274 LT S Sbjct: 683 LTPAKS 688 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,679,155 Number of Sequences: 27780 Number of extensions: 245440 Number of successful extensions: 562 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1777507862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -