BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0725 (700 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0UA19 Cluster: ATP/GTP-binding site motif A; n=10; Bur... 35 2.2 UniRef50_A6CFH9 Cluster: 2-dehydro-3-deoxyphosphooctonate aldola... 33 6.7 UniRef50_A5K5H8 Cluster: Putative uncharacterized protein; n=1; ... 33 6.7 >UniRef50_A0UA19 Cluster: ATP/GTP-binding site motif A; n=10; Burkholderia|Rep: ATP/GTP-binding site motif A - Burkholderia cenocepacia MC0-3 Length = 383 Score = 34.7 bits (76), Expect = 2.2 Identities = 30/109 (27%), Positives = 46/109 (42%) Frame = -2 Query: 438 PQPDTVRDTLAYIPDRSRYNDLFRTLNPLKARNTSDASDSAVGYSDATTTLTSLPEIRNL 259 PQ D V DT++ +PD + +L R+ PL A D AV L E Sbjct: 10 PQTDRVADTMSVLPDDASVTELMRSFAPLLA-------DEAVTELVINRPQRILTETHRG 62 Query: 258 WHAHKLNKYQRIKGIFCFFFSIFNLETNEE*PSKTSVRKEIIEGTARSQ 112 W AH L + + + F +I L TN+ ++ + ++ AR Q Sbjct: 63 WQAHDLPELD-FERLMAFAVAIATL-TNQSVSTEHPLLSALLPDNARLQ 109 >UniRef50_A6CFH9 Cluster: 2-dehydro-3-deoxyphosphooctonate aldolase; n=1; Planctomyces maris DSM 8797|Rep: 2-dehydro-3-deoxyphosphooctonate aldolase - Planctomyces maris DSM 8797 Length = 563 Score = 33.1 bits (72), Expect = 6.7 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = -2 Query: 270 IRNLWHAHKLNKYQRIKGIFCFFFSIFNLETNEE*PSKTSVRKEIIEGTA 121 + NL H + I G+FCF I E+ PS ++ KE +GTA Sbjct: 3 LSNLIRRHSAPRLGMISGVFCFALLISISGCKEQTPSSSTANKEKSQGTA 52 >UniRef50_A5K5H8 Cluster: Putative uncharacterized protein; n=1; Plasmodium vivax|Rep: Putative uncharacterized protein - Plasmodium vivax Length = 932 Score = 33.1 bits (72), Expect = 6.7 Identities = 20/47 (42%), Positives = 26/47 (55%) Frame = -2 Query: 375 LFRTLNPLKARNTSDASDSAVGYSDATTTLTSLPEIRNLWHAHKLNK 235 +FR +NP K N DA DSA G S + + S P+ NL K+NK Sbjct: 164 IFRFVNPRK--NEGDAGDSARGPSCYNSHVVSSPQNYNLSEIKKMNK 208 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 600,055,107 Number of Sequences: 1657284 Number of extensions: 10547462 Number of successful extensions: 24036 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24033 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -