BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0723 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 107 9e-26 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 84 1e-18 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 81 7e-18 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 81 1e-17 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 81 1e-17 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 78 7e-17 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 78 7e-17 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 78 7e-17 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 78 7e-17 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 78 7e-17 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 78 7e-17 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 78 7e-17 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 78 9e-17 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 78 9e-17 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 78 9e-17 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 76 3e-16 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 76 3e-16 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 76 3e-16 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 75 5e-16 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 75 5e-16 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 75 5e-16 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 75 8e-16 X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. 72 6e-15 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 72 6e-15 AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A prot... 72 6e-15 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 72 6e-15 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 71 1e-14 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 71 1e-14 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 70 2e-14 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 70 2e-14 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 67 2e-13 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 66 3e-13 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 62 3e-12 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 62 5e-12 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 60 2e-11 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 58 7e-11 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 58 1e-10 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 55 7e-10 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 54 2e-09 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 50 2e-08 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 50 2e-08 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 46 3e-07 AY563109-1|AAS99587.1| 46|Tribolium castaneum aristaless protein. 44 1e-06 EU056827-1|ABU40240.1| 22|Tribolium castaneum prothoraxless pr... 24 1.5 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 2.0 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 23 2.0 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 3.4 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 4.6 EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport pe... 21 8.0 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 21 8.0 AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 21 8.0 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 21 8.0 AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esteras... 21 8.0 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 107 bits (257), Expect = 9e-26 Identities = 65/108 (60%), Positives = 74/108 (68%), Gaps = 1/108 (0%) Frame = +1 Query: 430 SPSKSQGQRSPSLS-SDSRNGTPSPPLAHPEELLPGYSKDLKRLPLKEDSSKRIRTAFTG 606 SP +S + +S S + TPSPP PEE L P K+ SSKRI TAFT Sbjct: 79 SPKRSSPILAEKVSVSPTTPPTPSPP---PEERLT---------PSKDASSKRIXTAFTS 126 Query: 607 TQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 TQLLELEREF+ NMYLSRLRRIEIA+ L+LSEKQVKIWFQNR+VK K Sbjct: 127 TQLLELEREFASNMYLSRLRRIEIATCLRLSEKQVKIWFQNRRVKYKK 174 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 22 MSRSFLVDTLI 54 MSRSFLVD+LI Sbjct: 3 MSRSFLVDSLI 13 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 84.2 bits (199), Expect = 1e-18 Identities = 44/90 (48%), Positives = 60/90 (66%), Gaps = 1/90 (1%) Frame = +1 Query: 475 DSRNGTPSPPLAHPEELLPGYSKDLKRLPLKEDS-SKRIRTAFTGTQLLELEREFSMNMY 651 D +G SP + PE K ++ +E+ +R+RTA+T TQLLELE+EF N Y Sbjct: 100 DVPHGMGSPGVNVPEYPWMKEKKTTRKSSQQENGLPRRLRTAYTNTQLLELEKEFHFNKY 159 Query: 652 LSRLRRIEIASRLKLSEKQVKIWFQNRKVK 741 L R RRIEIA+ L L+E+QVK+WFQNR++K Sbjct: 160 LCRPRRIEIAASLDLTERQVKVWFQNRRMK 189 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 81.4 bits (192), Expect = 7e-18 Identities = 36/54 (66%), Positives = 46/54 (85%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVK 741 +R+RTA+T TQLLELE+EF N YL R RRIEIA+ L L+E+QVK+WFQNR++K Sbjct: 5 RRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMK 58 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 80.6 bits (190), Expect = 1e-17 Identities = 38/62 (61%), Positives = 46/62 (74%) Frame = +1 Query: 565 KEDSSKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKL 744 K + KR RTA+T QL+ELEREF YLSR RRI+IA L LSE+Q+KIWFQNR++K Sbjct: 84 KPTAGKRARTAYTSAQLVELEREFHHGKYLSRPRRIQIAENLNLSERQIKIWFQNRRMKH 143 Query: 745 XK 750 K Sbjct: 144 KK 145 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 80.6 bits (190), Expect = 1e-17 Identities = 38/62 (61%), Positives = 46/62 (74%) Frame = +1 Query: 565 KEDSSKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKL 744 K + KR RTA+T QL+ELEREF YLSR RRI+IA L LSE+Q+KIWFQNR++K Sbjct: 75 KPTAGKRARTAYTSAQLVELEREFHHGKYLSRPRRIQIAENLNLSERQIKIWFQNRRMKH 134 Query: 745 XK 750 K Sbjct: 135 KK 136 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 78.2 bits (184), Expect = 7e-17 Identities = 48/122 (39%), Positives = 76/122 (62%), Gaps = 2/122 (1%) Frame = +1 Query: 391 SVSPYLHHPYKTTSPSKSQGQRSPSLSSDSRNGTPSPPLAHPEELLPGYSK-DLKRLPLK 567 + S L P +TS S S +++ + +++S++G S +P ++ P + L + + Sbjct: 161 TASQNLSSPASSTS-STSSTEKAGTNNNNSKSGQSS----NPPQIYPWMKRVHLGQSTVN 215 Query: 568 EDS-SKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKL 744 + +KR RT++T Q LELE+EF N YL+R RRIEIA L L+E+Q+KIWFQNR++K Sbjct: 216 ANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 275 Query: 745 XK 750 K Sbjct: 276 KK 277 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 78.2 bits (184), Expect = 7e-17 Identities = 35/64 (54%), Positives = 47/64 (73%) Frame = +1 Query: 559 PLKEDSSKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKV 738 P + KR RTA+T +QL+ELEREF + YL R RRI++A L L+E+Q+KIWFQNR++ Sbjct: 79 PKGASNGKRARTAYTSSQLVELEREFHRSKYLCRPRRIQMAQNLNLTERQIKIWFQNRRM 138 Query: 739 KLXK 750 K K Sbjct: 139 KFKK 142 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 78.2 bits (184), Expect = 7e-17 Identities = 48/122 (39%), Positives = 76/122 (62%), Gaps = 2/122 (1%) Frame = +1 Query: 391 SVSPYLHHPYKTTSPSKSQGQRSPSLSSDSRNGTPSPPLAHPEELLPGYSK-DLKRLPLK 567 + S L P +TS S S +++ + +++S++G S +P ++ P + L + + Sbjct: 161 TASQNLSSPASSTS-STSSTEKAGTNNNNSKSGQSS----NPPQIYPWMKRVHLGQSTVN 215 Query: 568 EDS-SKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKL 744 + +KR RT++T Q LELE+EF N YL+R RRIEIA L L+E+Q+KIWFQNR++K Sbjct: 216 ANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 275 Query: 745 XK 750 K Sbjct: 276 KK 277 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 78.2 bits (184), Expect = 7e-17 Identities = 48/122 (39%), Positives = 76/122 (62%), Gaps = 2/122 (1%) Frame = +1 Query: 391 SVSPYLHHPYKTTSPSKSQGQRSPSLSSDSRNGTPSPPLAHPEELLPGYSK-DLKRLPLK 567 + S L P +TS S S +++ + +++S++G S +P ++ P + L + + Sbjct: 117 TASQNLSSPASSTS-STSSTEKAGTNNNNSKSGQSS----NPPQIYPWMKRVHLGQSTVN 171 Query: 568 EDS-SKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKL 744 + +KR RT++T Q LELE+EF N YL+R RRIEIA L L+E+Q+KIWFQNR++K Sbjct: 172 ANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 231 Query: 745 XK 750 K Sbjct: 232 KK 233 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 78.2 bits (184), Expect = 7e-17 Identities = 35/64 (54%), Positives = 47/64 (73%) Frame = +1 Query: 559 PLKEDSSKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKV 738 P + KR RTA+T +QL+ELEREF + YL R RRI++A L L+E+Q+KIWFQNR++ Sbjct: 99 PKGASNGKRARTAYTSSQLVELEREFHRSKYLCRPRRIQMAQNLNLTERQIKIWFQNRRM 158 Query: 739 KLXK 750 K K Sbjct: 159 KFKK 162 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 78.2 bits (184), Expect = 7e-17 Identities = 48/122 (39%), Positives = 76/122 (62%), Gaps = 2/122 (1%) Frame = +1 Query: 391 SVSPYLHHPYKTTSPSKSQGQRSPSLSSDSRNGTPSPPLAHPEELLPGYSK-DLKRLPLK 567 + S L P +TS S S +++ + +++S++G S +P ++ P + L + + Sbjct: 161 TASQNLSSPASSTS-STSSTEKAGTNNNNSKSGQSS----NPPQIYPWMKRVHLGQSTVN 215 Query: 568 EDS-SKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKL 744 + +KR RT++T Q LELE+EF N YL+R RRIEIA L L+E+Q+KIWFQNR++K Sbjct: 216 ANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 275 Query: 745 XK 750 K Sbjct: 276 KK 277 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 78.2 bits (184), Expect = 7e-17 Identities = 48/122 (39%), Positives = 76/122 (62%), Gaps = 2/122 (1%) Frame = +1 Query: 391 SVSPYLHHPYKTTSPSKSQGQRSPSLSSDSRNGTPSPPLAHPEELLPGYSK-DLKRLPLK 567 + S L P +TS S S +++ + +++S++G S +P ++ P + L + + Sbjct: 161 TASQNLSSPASSTS-STSSTEKAGTNNNNSKSGQSS----NPPQIYPWMKRVHLGQSTVN 215 Query: 568 EDS-SKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKL 744 + +KR RT++T Q LELE+EF N YL+R RRIEIA L L+E+Q+KIWFQNR++K Sbjct: 216 ANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 275 Query: 745 XK 750 K Sbjct: 276 KK 277 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 77.8 bits (183), Expect = 9e-17 Identities = 37/57 (64%), Positives = 45/57 (78%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 KR RTA+T Q+LELE+EF N YL+R RRIEIA L LSE+Q+KIWFQNR++K K Sbjct: 234 KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK 290 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 77.8 bits (183), Expect = 9e-17 Identities = 44/111 (39%), Positives = 68/111 (61%), Gaps = 3/111 (2%) Frame = +1 Query: 427 TSPSKSQGQRSPS-LSSDSRNGTPSPPLAHPEELLPGYSK-DLKRLPLKEDS-SKRIRTA 597 +SP+ S S + + + N + S ++P ++ P + L + + + +KR RT+ Sbjct: 167 SSPASSTSSTSSTEKAGTNNNNSKSSQSSNPPQIYPWMKRVHLGQSTVNANGETKRQRTS 226 Query: 598 FTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 +T Q LELE+EF N YL+R RRIEIA L L+E+Q+KIWFQNR++K K Sbjct: 227 YTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 277 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 77.8 bits (183), Expect = 9e-17 Identities = 37/57 (64%), Positives = 45/57 (78%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 KR RTA+T Q+LELE+EF N YL+R RRIEIA L LSE+Q+KIWFQNR++K K Sbjct: 234 KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKK 290 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 75.8 bits (178), Expect = 3e-16 Identities = 36/54 (66%), Positives = 42/54 (77%) Frame = +1 Query: 589 RTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 RT FT QL ELE+EF N YL+R RRIEIAS L+L+E QVKIWFQNR++K K Sbjct: 257 RTNFTNKQLTELEKEFHFNKYLTRARRIEIASALQLNETQVKIWFQNRRMKQKK 310 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 75.8 bits (178), Expect = 3e-16 Identities = 36/54 (66%), Positives = 42/54 (77%) Frame = +1 Query: 589 RTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 RT FT QL ELE+EF N YL+R RRIEIAS L+L+E QVKIWFQNR++K K Sbjct: 46 RTNFTNKQLTELEKEFHFNKYLTRARRIEIASALQLNETQVKIWFQNRRMKQKK 99 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 75.8 bits (178), Expect = 3e-16 Identities = 36/54 (66%), Positives = 42/54 (77%) Frame = +1 Query: 589 RTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 RT FT QL ELE+EF N YL+R RRIEIAS L+L+E QVKIWFQNR++K K Sbjct: 46 RTNFTNKQLTELEKEFHFNKYLTRARRIEIASALQLNETQVKIWFQNRRMKQKK 99 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 75.4 bits (177), Expect = 5e-16 Identities = 34/58 (58%), Positives = 44/58 (75%) Frame = +1 Query: 577 SKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 +KR R +T Q LELE+EF N YL+R RRIEIA L+L+E+Q+KIWFQNR++K K Sbjct: 183 NKRTRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAESLRLTERQIKIWFQNRRMKAKK 240 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 75.4 bits (177), Expect = 5e-16 Identities = 34/58 (58%), Positives = 44/58 (75%) Frame = +1 Query: 577 SKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 +KR R +T Q LELE+EF N YL+R RRIEIA L+L+E+Q+KIWFQNR++K K Sbjct: 183 NKRTRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAESLRLTERQIKIWFQNRRMKAKK 240 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 75.4 bits (177), Expect = 5e-16 Identities = 34/58 (58%), Positives = 44/58 (75%) Frame = +1 Query: 577 SKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 +KR R +T Q LELE+EF N YL+R RRIEIA L+L+E+Q+KIWFQNR++K K Sbjct: 183 NKRTRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAESLRLTERQIKIWFQNRRMKAKK 240 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 74.5 bits (175), Expect = 8e-16 Identities = 35/58 (60%), Positives = 45/58 (77%) Frame = +1 Query: 577 SKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 +KR RT++T Q LELE+EF N YL+R RRIEIA L L+E+Q+KIWFQNR++K K Sbjct: 8 TKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 65 >X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. Length = 133 Score = 71.7 bits (168), Expect = 6e-15 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 +R R +T Q LELE+EF N YL+R RRIEIA L L+E+Q+KIWFQNR++KL K Sbjct: 7 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 63 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 71.7 bits (168), Expect = 6e-15 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQN 729 KR RTA+T Q+LELE+EF N YL+R RRIEIA L LSE+Q+KIWFQN Sbjct: 234 KRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQN 283 >AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A protein. Length = 284 Score = 71.7 bits (168), Expect = 6e-15 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 +R R +T Q LELE+EF N YL+R RRIEIA L L+E+Q+KIWFQNR++KL K Sbjct: 158 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 214 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 71.7 bits (168), Expect = 6e-15 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 +R R +T Q LELE+EF N YL+R RRIEIA L L+E+Q+KIWFQNR++KL K Sbjct: 217 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 273 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 70.9 bits (166), Expect = 1e-14 Identities = 34/57 (59%), Positives = 42/57 (73%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 KR R +T Q LELE+EF N YL+R RRIEIA L L+E+Q+KIWFQNR++K K Sbjct: 243 KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 299 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 70.9 bits (166), Expect = 1e-14 Identities = 34/57 (59%), Positives = 42/57 (73%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 KR R +T Q LELE+EF N YL+R RRIEIA L L+E+Q+KIWFQNR++K K Sbjct: 245 KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 301 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 70.1 bits (164), Expect = 2e-14 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 +R R +T Q LELE+EF N YL+R RRIE+A L L+E+Q+KIWFQNR++KL K Sbjct: 224 RRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 280 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 70.1 bits (164), Expect = 2e-14 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 +R R +T Q LELE+EF N YL+R RRIE+A L L+E+Q+KIWFQNR++KL K Sbjct: 6 RRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 62 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 66.9 bits (156), Expect = 2e-13 Identities = 29/57 (50%), Positives = 42/57 (73%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 KR RTAF+G QL L+ EF+ N YL+ RR ++++ L L+E Q+KIWFQN++ K+ K Sbjct: 229 KRPRTAFSGAQLARLKHEFAENRYLTERRRQQLSAELGLNEAQIKIWFQNKRAKIKK 285 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 66.1 bits (154), Expect = 3e-13 Identities = 29/60 (48%), Positives = 42/60 (70%) Frame = +1 Query: 562 LKEDSSKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVK 741 + + + +R RTAFT QL LE+EF Y+SR RR E+A++L L E +K+WFQNR++K Sbjct: 66 VNDQNIRRYRTAFTREQLARLEKEFFKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMK 125 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 62.5 bits (145), Expect = 3e-12 Identities = 30/59 (50%), Positives = 39/59 (66%) Frame = +1 Query: 565 KEDSSKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVK 741 K +++ RT FT QLL LE++F YLS R E +S L+L+E QVKIWFQNR+ K Sbjct: 111 KHKPNRKPRTPFTTQQLLALEKKFRDKQYLSIAERAEFSSSLRLTEPQVKIWFQNRRAK 169 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 62.1 bits (144), Expect = 5e-12 Identities = 28/57 (49%), Positives = 41/57 (71%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKLXK 750 ++ R ++ Q LELE+EF N Y+S+ +R E+A L L+E+QVKIWFQNR++K K Sbjct: 244 RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLNLTERQVKIWFQNRRMKNKK 300 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 60.1 bits (139), Expect = 2e-11 Identities = 28/62 (45%), Positives = 41/62 (66%) Frame = +1 Query: 565 KEDSSKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKL 744 K + + R +T Q +ELE+EF + Y++ R+ E+A+ L LSE+QVKIWFQNR+ K Sbjct: 152 KTRTKDKYRVVYTDHQRVELEKEFYYSRYITIRRKAELANSLGLSERQVKIWFQNRRAKE 211 Query: 745 XK 750 K Sbjct: 212 RK 213 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 58.0 bits (134), Expect = 7e-11 Identities = 28/65 (43%), Positives = 39/65 (60%) Frame = +1 Query: 556 LPLKEDSSKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRK 735 +PLK +R RT FT QL ELE+ F Y R E+A R KL+E ++++WF NR+ Sbjct: 214 IPLKR-KQRRSRTTFTAHQLDELEKAFERTQYPDIYTREELAQRTKLTEARIQVWFSNRR 272 Query: 736 VKLXK 750 +L K Sbjct: 273 ARLRK 277 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 57.6 bits (133), Expect = 1e-10 Identities = 27/63 (42%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = +1 Query: 565 KEDSSKRIRTAFTGTQLLELEREFS-MNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVK 741 K + + R +T Q +ELE+EF+ ++ Y++ R+ E+A L LSE+Q+KIWFQNR+ K Sbjct: 152 KTRTKDKYRVVYTDLQRIELEKEFTFVSKYITIKRKSELAENLGLSERQIKIWFQNRRAK 211 Query: 742 LXK 750 K Sbjct: 212 ERK 214 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 54.8 bits (126), Expect = 7e-10 Identities = 26/62 (41%), Positives = 37/62 (59%) Frame = +1 Query: 565 KEDSSKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVKL 744 K ++ RT ++ QL +L R F YL+ R E+A+ L L++ QVKIWFQNR+ K Sbjct: 117 KGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKY 176 Query: 745 XK 750 K Sbjct: 177 KK 178 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 53.6 bits (123), Expect = 2e-09 Identities = 38/109 (34%), Positives = 63/109 (57%), Gaps = 2/109 (1%) Frame = +1 Query: 391 SVSPYLHHPYKTTSPSKSQGQRSPSLSSDSRNGTPSPPLAHPEELLPGYSK-DLKRLPLK 567 + S L P +TS S S +++ + +++S++G S +P ++ P + L + + Sbjct: 161 TASQNLSSPASSTS-STSSTEKAGTNNNNSKSGQSS----NPPQIYPWMKRVHLGQSTVN 215 Query: 568 EDS-SKRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQV 711 + +KR RT++T Q LELE+EF N YL+R RRIEIA L L+ K + Sbjct: 216 ANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTNKNL 264 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 50.4 bits (115), Expect = 2e-08 Identities = 24/54 (44%), Positives = 32/54 (59%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVK 741 ++ R F+ Q ELER F YLS R +AS ++L+ QVKIWFQN + K Sbjct: 41 RKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASIIRLTPTQVKIWFQNHRYK 94 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 50.0 bits (114), Expect = 2e-08 Identities = 37/112 (33%), Positives = 51/112 (45%), Gaps = 7/112 (6%) Frame = +1 Query: 427 TSPSKSQGQRSPSLSSD---SRNGTPSPPLA----HPEELLPGYSKDLKRLPLKEDSSKR 585 T+P PSLSS +G P P L HP E +P + +R Sbjct: 70 TAPHGPPYAPHPSLSSGLGGGLSGMPMPALGFGLGHPLESVPFPQVYSYFAGVNPRKQRR 129 Query: 586 IRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVK 741 RT FT QL LE F+ Y R E+A ++ L E +V++WF+NR+ K Sbjct: 130 ERTTFTRAQLDLLEGLFAKTRYPDIFMREEVAVKINLPESRVQVWFKNRRAK 181 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 46.0 bits (104), Expect = 3e-07 Identities = 22/54 (40%), Positives = 31/54 (57%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQNRKVK 741 +R RT FT QL LE F Y R E+A ++ L E +V++WF+NR+ K Sbjct: 70 RRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAK 123 >AY563109-1|AAS99587.1| 46|Tribolium castaneum aristaless protein. Length = 46 Score = 44.4 bits (100), Expect = 1e-06 Identities = 20/46 (43%), Positives = 29/46 (63%) Frame = +1 Query: 589 RTAFTGTQLLELEREFSMNMYLSRLRRIEIASRLKLSEKQVKIWFQ 726 RT FT QL ELE+ FS Y R E+A ++ L+E ++++WFQ Sbjct: 1 RTTFTSYQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQ 46 >EU056827-1|ABU40240.1| 22|Tribolium castaneum prothoraxless protein. Length = 22 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 580 KRIRTAFTGTQLLELEREF 636 KR R +T Q LELE+EF Sbjct: 2 KRGRQTYTRYQTLELEKEF 20 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 244 EQLHFRYPILHQLPHQPELVESQNESRP 327 E + F + H+L LVE Q+E +P Sbjct: 153 EYISFESKVFHKLKKMKYLVEVQDEVKP 180 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 23.4 bits (48), Expect = 2.0 Identities = 8/21 (38%), Positives = 17/21 (80%) Frame = +1 Query: 610 QLLELEREFSMNMYLSRLRRI 672 ++LELER+ + ++++ + RRI Sbjct: 70 EILELERDANFSLFIPKHRRI 90 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 3.4 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 385 KKSVSPYL--HHPYKTTSPSKSQGQRSPSLSSDSRNGTP 495 K SVSP P +T + S + SP+ SSD R+GTP Sbjct: 910 KPSVSPLTSPRQPAETHAGSPCRNSASPA-SSD-RSGTP 946 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -1 Query: 402 WRYRLLPSIHEIHWLLILGFQEA 334 WR + ++H HW L+ F+ A Sbjct: 197 WREDIGLNLHHWHWHLVYPFEGA 219 >EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport peptide isoform B protein. Length = 120 Score = 21.4 bits (43), Expect = 8.0 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -2 Query: 152 NLGRGSKCEPIKLVYGLKESLAMSDFFESFVSLIRVSTK 36 NL R S+C K G ESL +S+ F +I +K Sbjct: 83 NLCR-SECFSTKYFVGCVESLLLSEEMPKFRKMIEYLSK 120 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +1 Query: 421 KTTSPSKSQGQRSPSLSSDSRNGTPSPP 504 K+++ K P + ++ TPSPP Sbjct: 205 KSSAKRKQLVSEHPDSPNSKKSATPSPP 232 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 181 LSFPDMGTARTWVVDPSVSRL 119 ++F D+GT T VDP R+ Sbjct: 498 MNFLDIGTKLTTGVDPDSDRM 518 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 181 LSFPDMGTARTWVVDPSVSRL 119 ++F D+GT T VDP R+ Sbjct: 498 MNFLDIGTKLTTGVDPDSERM 518 >AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 181 LSFPDMGTARTWVVDPSVSRL 119 ++F D+GT T VDP R+ Sbjct: 498 MNFLDIGTKLTTGVDPDSDRM 518 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.135 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,744 Number of Sequences: 336 Number of extensions: 3745 Number of successful extensions: 61 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -