BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0722 (600 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 22 3.4 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 7.9 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 22.2 bits (45), Expect = 3.4 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = -3 Query: 475 HFRWIHCSVLLTFTLLISTVFCSNKNLYK-FDNEFIIFKTIT*LSIIESY 329 HF + VL T +FC++ + YK F ++ + IT L S+ Sbjct: 54 HFTFKSWKVLYTSLTSFGYLFCASLSFYKAFKIGILLNQLITPLFFFHSF 103 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 Query: 476 IRGGIHRNKGCHLKYCVKTLIEDM 547 IR + CHLK+ TL +++ Sbjct: 165 IRCAFLERENCHLKFVTDTLKKEL 188 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,196 Number of Sequences: 336 Number of extensions: 2174 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -