BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0713 (740 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U55375-6|AAC69046.2| 431|Caenorhabditis elegans Hypothetical pr... 30 1.5 AC024770-9|AAF59487.2| 131|Caenorhabditis elegans Hypothetical ... 28 6.0 >U55375-6|AAC69046.2| 431|Caenorhabditis elegans Hypothetical protein K03E6.7 protein. Length = 431 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 82 NIEKRDVMESMKNAWNEVVKTLSDAGDAVVHVFKPTEKSV 201 NI D + M + +E++K + A D V H+ KP KSV Sbjct: 387 NIGDDDTVSKMLMSHSELIKDIELATDRVGHILKPNIKSV 426 >AC024770-9|AAF59487.2| 131|Caenorhabditis elegans Hypothetical protein Y39H10A.1 protein. Length = 131 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 88 EKRDVMESMKNAWNEVVKTLSDAGDAVVHVFKPTEKSVIDKMADS 222 ++RD E +KNA + T+ AG+A V K D + D+ Sbjct: 67 KRRDASEDIKNAGRNAIGTVDSAGNAAVDKAGELVKGGTDHIKDA 111 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,627,771 Number of Sequences: 27780 Number of extensions: 326865 Number of successful extensions: 779 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -