BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0710 (700 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9K8J1 Cluster: Protease; n=1; Bacillus halodurans|Rep:... 40 0.078 UniRef50_Q7UZC5 Cluster: Putative uncharacterized protein; n=1; ... 34 3.9 UniRef50_A7AR16 Cluster: GCC2 and GCC3 domain containing protein... 33 6.7 >UniRef50_Q9K8J1 Cluster: Protease; n=1; Bacillus halodurans|Rep: Protease - Bacillus halodurans Length = 289 Score = 39.5 bits (88), Expect = 0.078 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = +2 Query: 428 VFFSYHENVWIFFHFLI*NSFLENKTKHIFFILLIQSMFNIPLNKTAKINL 580 + + +H N+W+ FLI N++LE K H FI + F I L++ K +L Sbjct: 176 ILYPFHLNLWLVLTFLIVNNYLEYKQCHYRFIRFLTERFYIGLSQQGKPHL 226 >UniRef50_Q7UZC5 Cluster: Putative uncharacterized protein; n=1; Pirellula sp.|Rep: Putative uncharacterized protein - Rhodopirellula baltica Length = 275 Score = 33.9 bits (74), Expect = 3.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 197 EAIS*IAVSGQTITRHPDPRNLW*HSPVLYCS 102 + IS +AV G +R + N W H P++YCS Sbjct: 184 DVISPVAVVGHIASRETNTANTWGHEPIVYCS 215 >UniRef50_A7AR16 Cluster: GCC2 and GCC3 domain containing protein; n=1; Babesia bovis|Rep: GCC2 and GCC3 domain containing protein - Babesia bovis Length = 2953 Score = 33.1 bits (72), Expect = 6.7 Identities = 19/54 (35%), Positives = 23/54 (42%) Frame = +3 Query: 18 RTLPCPPTCRAVGSYLQTLLQDSCGAWT*AIEDG*MLPKISRVRMSGDCLPRHS 179 R LPCPP G + Q C A M+ ++SR RM LPR S Sbjct: 1777 RCLPCPPMMTTTGRGAVSASQCVCNVGYFATTSNTMMRQLSRARMLPPVLPRRS 1830 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 617,224,787 Number of Sequences: 1657284 Number of extensions: 11483956 Number of successful extensions: 25294 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 24331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25286 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -