BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0710 (700 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L04791-1|AAA52397.1| 1493|Homo sapiens excision repair protein p... 30 6.9 BC127104-1|AAI27105.1| 1493|Homo sapiens excision repair cross-c... 30 6.9 AY204752-1|AAO13487.1| 1493|Homo sapiens excision repair cross-c... 30 6.9 AL138760-2|CAH70291.1| 1493|Homo sapiens excision repair cross-c... 30 6.9 >L04791-1|AAA52397.1| 1493|Homo sapiens excision repair protein protein. Length = 1493 Score = 30.3 bits (65), Expect = 6.9 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 88 AGLGHEQ*RTGECYQRFRGSGCRVIVCPDTAI 183 AGL + + RT RF G G VIVCP T + Sbjct: 547 AGLSYSKIRTRGSNYRFEGLGPTVIVCPTTVM 578 >BC127104-1|AAI27105.1| 1493|Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation g protein. Length = 1493 Score = 30.3 bits (65), Expect = 6.9 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 88 AGLGHEQ*RTGECYQRFRGSGCRVIVCPDTAI 183 AGL + + RT RF G G VIVCP T + Sbjct: 547 AGLSYSKIRTRGSNYRFEGLGPTVIVCPTTVM 578 >AY204752-1|AAO13487.1| 1493|Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation g protein. Length = 1493 Score = 30.3 bits (65), Expect = 6.9 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 88 AGLGHEQ*RTGECYQRFRGSGCRVIVCPDTAI 183 AGL + + RT RF G G VIVCP T + Sbjct: 547 AGLSYSKIRTRGSNYRFEGLGPTVIVCPTTVM 578 >AL138760-2|CAH70291.1| 1493|Homo sapiens excision repair cross-complementing rodent repairnt regulator of chromatin, sub protein. Length = 1493 Score = 30.3 bits (65), Expect = 6.9 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 88 AGLGHEQ*RTGECYQRFRGSGCRVIVCPDTAI 183 AGL + + RT RF G G VIVCP T + Sbjct: 547 AGLSYSKIRTRGSNYRFEGLGPTVIVCPTTVM 578 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,847,023 Number of Sequences: 237096 Number of extensions: 1727808 Number of successful extensions: 6734 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6734 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -