BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0707 (350 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0521 + 3768072-3768239,3768280-3768337,3769197-3769659,376... 27 4.1 11_04_0160 + 14247463-14247584,14247710-14247923,14250099-142502... 26 7.2 >02_01_0521 + 3768072-3768239,3768280-3768337,3769197-3769659, 3769736-3769990,3770763-3770934,3772260-3772910, 3773659-3774045,3774123-3774155,3774239-3774307, 3774388-3774463,3775135-3775223,3775442-3775615, 3775693-3775821 Length = 907 Score = 27.1 bits (57), Expect = 4.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = -1 Query: 110 VCTYLPIDNTATANNILDLLLRVEHQRKTQKF 15 +C++L +D+ ATA + L+V H+R + + Sbjct: 149 LCSFLLVDSLATAESYQSCSLKVNHKRVAKAY 180 >11_04_0160 + 14247463-14247584,14247710-14247923,14250099-14250215, 14251578-14251670,14251748-14251922,14252981-14253017, 14253842-14253875,14254212-14254481,14255768-14255872, 14256295-14256392,14256474-14256616,14257197-14257290, 14257378-14257487,14258018-14258172,14258252-14258332, 14258415-14258535,14259358-14259464,14259537-14259668, 14261105-14261258,14264094-14264211,14264344-14264517, 14264831-14264882,14265450-14265577,14265670-14265820, 14265904-14266242 Length = 1107 Score = 26.2 bits (55), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -1 Query: 350 FFFFFSINYFLCNIKNTIQN*FKFRVCSQNMYLI 249 F F+ IN+F+ +I + FR+C Q Y + Sbjct: 959 FIAFYIINFFISSIPSAGMYTIMFRLCRQPTYWV 992 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,843,827 Number of Sequences: 37544 Number of extensions: 103473 Number of successful extensions: 171 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 171 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 518263348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -