BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0707 (350 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY204751-1|AAP13576.1| 5058|Homo sapiens ABC A13 protein. 31 1.0 AK128570-1|BAC87504.1| 851|Homo sapiens protein ( Homo sapiens ... 31 1.0 AF501281-1|AAO59914.1| 2127|Homo sapiens ATP binding cassette tr... 31 1.0 >AY204751-1|AAP13576.1| 5058|Homo sapiens ABC A13 protein. Length = 5058 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 216 LLILNCKFKFLNKNILCVLLKTIMGMGYLFV 124 LL+L+ + F+N+ LC+L T G G F+ Sbjct: 3696 LLVLHNQLSFVNQTFLCLLSTTAFGQGVFFI 3726 >AK128570-1|BAC87504.1| 851|Homo sapiens protein ( Homo sapiens cDNA FLJ46729 fis, clone TRACH3019370, weakly similar to ATP-binding cassette, sub-family A, member 1. ). Length = 851 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 216 LLILNCKFKFLNKNILCVLLKTIMGMGYLFV 124 LL+L+ + F+N+ LC+L T G G F+ Sbjct: 451 LLVLHNQLSFVNQTFLCLLSTTAFGQGVFFI 481 >AF501281-1|AAO59914.1| 2127|Homo sapiens ATP binding cassette transporter A13 protein. Length = 2127 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 216 LLILNCKFKFLNKNILCVLLKTIMGMGYLFV 124 LL+L+ + F+N+ LC+L T G G F+ Sbjct: 764 LLVLHNQLSFVNQTFLCLLSTTAFGQGVFFI 794 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,624,615 Number of Sequences: 237096 Number of extensions: 679801 Number of successful extensions: 4846 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4846 length of database: 76,859,062 effective HSP length: 80 effective length of database: 57,891,382 effective search space used: 2084089752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -