BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0702 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 22 6.0 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 22 6.0 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 388 TNLKTWVIQTRRSLKKK 438 T + TW RR LKK+ Sbjct: 129 TQVSTWFANARRRLKKE 145 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/43 (27%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -1 Query: 708 IXQIYP-RAYMLAXGICRQLRCHSSTLRHVCSL*YMHLVCLVL 583 + QIY +++ G+ ++ + H+C L + LVC VL Sbjct: 87 VVQIYIFSGFIVPSGVVYKIGYWLHQICHICELHTIFLVCNVL 129 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,227 Number of Sequences: 336 Number of extensions: 3181 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -