BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0701 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 23 2.6 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 23 2.6 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 23 3.4 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 23 3.4 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = +2 Query: 14 KFWNAEKVKSFIQDKCKSRTIPENIKFVLLFIEDNGDPSCLVKFAN 151 KF + +K F + +R + +N+ EDNG ++ F+N Sbjct: 465 KFASLKKSPYFKEANLNTRMLNDNVFAFSRETEDNGSLYAILNFSN 510 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = +2 Query: 14 KFWNAEKVKSFIQDKCKSRTIPENIKFVLLFIEDNGDPSCLVKFAN 151 KF + +K F + +R + +N+ EDNG ++ F+N Sbjct: 465 KFASLKKSPYFKEANLNTRMLNDNVFAFSRETEDNGSLYAILNFSN 510 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 553 AEHLAQLRLRNQDVQVPNEDLV 488 +E + LRL+ Q + +P DLV Sbjct: 288 SEEYSYLRLKGQMLYIPESDLV 309 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 553 AEHLAQLRLRNQDVQVPNEDLV 488 +E + LRL+ Q + +P DLV Sbjct: 288 SEEYSYLRLKGQMLYIPESDLV 309 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,651 Number of Sequences: 438 Number of extensions: 3427 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -