BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0698 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 21 6.7 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 8.8 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 8.8 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 8.8 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 21 8.8 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -3 Query: 585 YSXVQLWCIMPIPPQSAMDMAMSASVTVSIGVD 487 YS + P PPQ +M +M ++ S D Sbjct: 313 YSGTPTPMMSPAPPQDSMGYSMGSAYDQSSAYD 345 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 559 NANSTAKRHGYGHVSFCHCVHWSRH 485 N NS +GYG+ ++ H S H Sbjct: 69 NYNSNVLSNGYGYGNYYHPQLHSHH 93 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 559 NANSTAKRHGYGHVSFCHCVHWSRH 485 N NS +GYG+ ++ H S H Sbjct: 69 NYNSNVLSNGYGYGNYYHPQLHSHH 93 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 559 NANSTAKRHGYGHVSFCHCVHWSRH 485 N NS +GYG+ ++ H S H Sbjct: 69 NYNSNVLSNGYGYGNYYHPQLHSHH 93 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 559 NANSTAKRHGYGHVSFCHCVHWSRH 485 N NS +GYG+ ++ H S H Sbjct: 69 NYNSNVLSNGYGYGNYYHPQLHSHH 93 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,881 Number of Sequences: 336 Number of extensions: 2897 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -