BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0698 (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0175 + 32152428-32153423,32153692-32153889,32154942-321551... 81 1e-15 03_05_0207 - 21985340-21985570,21986430-21986636,21999578-219996... 31 1.1 04_03_0008 + 9296711-9298096 28 7.4 07_03_0105 + 13455906-13457198 27 9.8 03_01_0005 + 46370-46454,46962-47071,47381-47545,47672-48463,487... 27 9.8 >03_06_0175 + 32152428-32153423,32153692-32153889,32154942-32155121, 32156224-32156481,32157310-32157381 Length = 567 Score = 80.6 bits (190), Expect = 1e-15 Identities = 39/89 (43%), Positives = 55/89 (61%) Frame = +2 Query: 335 DGLSAEDTFANSEGLTYNDFLLLPGYIDFTAEEVDLTSPLTKKILLKAPLVSTPMDTVTE 514 DG A F+ TY+D + LPGYI F A+ VDL++ L+++I L P V++PMDTV+E Sbjct: 11 DGFPAPRLFSQGVSYTYDDVIFLPGYIGFPADAVDLSTRLSRRIPLSIPCVASPMDTVSE 70 Query: 515 ADMAISMALCGGIGIIHHNCTXEYQANEV 601 A MA +MA G ++H N QA+ V Sbjct: 71 AAMAAAMASLGAAAVVHCNTEPHLQASIV 99 >03_05_0207 - 21985340-21985570,21986430-21986636,21999578-21999667, 21999764-21999945,22000130-22001042,22003184-22003266, 22004622-22004939,22005044-22005107 Length = 695 Score = 30.7 bits (66), Expect = 1.1 Identities = 21/82 (25%), Positives = 31/82 (37%) Frame = -3 Query: 561 IMPIPPQSAMDMAMSASVTVSIGVDTRGAFNRIFLVSGDVKSTSSAVKSIYPGSSKKSLY 382 I+P+PP S IGV +N++ VK ++ + + KK Y Sbjct: 157 ILPLPPMDHSSSEESDVSDSDIGVHEEKTYNQLRAEKVKVKHGNNTFRCPFCPGKKKQDY 216 Query: 381 VSPSLLAKVSSADNPSRRSPSV 316 S LL S S+R V Sbjct: 217 SSKDLLQHASGVGAASKRKAKV 238 >04_03_0008 + 9296711-9298096 Length = 461 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 494 PMDTVTEADMAISMALCGGIGIIHHNCTXEYQ 589 P DTV D+ ++ +CGG G ++C ++ Sbjct: 131 PQDTVKALDLHVTCEVCGGTGHSGNDCPETHE 162 >07_03_0105 + 13455906-13457198 Length = 430 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 476 APLVSTPMDTVTEADMAISMALCGGI 553 A STP DT+ A S+ LCGG+ Sbjct: 251 AAAFSTPYDTIARHTDAKSVVLCGGV 276 >03_01_0005 + 46370-46454,46962-47071,47381-47545,47672-48463, 48730-48840,48935-49195,49415-49638,49735-49855, 50673-51214,51302-51488,51569-51895,52047-52197, 52287-52424,52918-53013,53276-53357,54411-54679, 54769-54882,55050-55288,55488-55715,55799-55951, 56479-56616,57061-57188,57598-57718,58142-58306, 59486-59633,59772-59898,60025-60118,60119-60268, 60577-60624,60712-60819,61040-61114,61225-61275, 61341-61487,61584-61714,61944-62031,62204-62266, 62336-62582,62830-62981,63056-63126,63214-63370, 63520-63687 Length = 2323 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/72 (19%), Positives = 31/72 (43%) Frame = +2 Query: 392 FLLLPGYIDFTAEEVDLTSPLTKKILLKAPLVSTPMDTVTEADMAISMALCGGIGIIHHN 571 +L++ ++D T E + + + + PL+ D V D + + ++H N Sbjct: 1028 YLVMHSFLDITWEHYLVCPQIVPRGFVLGPLLRGLNDVVHHKDFEFEVEILKNTALLHQN 1087 Query: 572 CTXEYQANEVHK 607 ++A+ V K Sbjct: 1088 YLAIFRADSVPK 1099 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,997,677 Number of Sequences: 37544 Number of extensions: 272400 Number of successful extensions: 787 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 785 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -