BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0696 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y09951-1|CAA71082.1| 107|Anopheles gambiae histone H2a protein. 27 0.57 Y09953-1|CAA71084.1| 91|Anopheles gambiae histone H4 protein. 23 9.2 >Y09951-1|CAA71082.1| 107|Anopheles gambiae histone H2a protein. Length = 107 Score = 27.1 bits (57), Expect = 0.57 Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = +3 Query: 384 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEENK--RRTLQRNDI 557 P+ RI ++++ + + APV A E E+ A + +NK RR + R + Sbjct: 11 PVGRIHRLLRKGNYAERVGPGAPVYLAAVMEYLAAEVLELAGNRARDNKKERRIIPRLQL 70 Query: 558 A 560 A Sbjct: 71 A 71 >Y09953-1|CAA71084.1| 91|Anopheles gambiae histone H4 protein. Length = 91 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +3 Query: 474 EIFIHELTLRAWSHTEENKRRTLQRNDIATAI 569 ++F+ + A ++TE KR+T+ D+ A+ Sbjct: 60 KVFLENVIRDAVAYTEHAKRKTVTAMDVVYAL 91 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 603,254 Number of Sequences: 2352 Number of extensions: 11002 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -