BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0694 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.8 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 5.3 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.3 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -2 Query: 137 REEKQNQAKEGFLHQETAGS 78 RE+ ++ KEG+LH +G+ Sbjct: 690 REQTESDDKEGYLHSVVSGA 709 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +2 Query: 647 VLIADQLNMLQHNLSXQPLHHNVATHVNKQRTQ 745 V+ + L +S HHNV H RTQ Sbjct: 1661 VISDSESGRLDTEMSTWGYHHNVNKHCTIHRTQ 1693 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 437 GMRNIEATVNSTLHSSKD 490 GM NIE + +T +SSK+ Sbjct: 193 GMNNIETYIVNTNYSSKN 210 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,529 Number of Sequences: 438 Number of extensions: 3124 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -