BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0690 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 24 1.5 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 23 2.6 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 23 2.6 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 21 8.0 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 97 RLERTDILSLTISHL 141 +LE+ DIL +T+ HL Sbjct: 74 KLEKADILEMTVKHL 88 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/38 (23%), Positives = 20/38 (52%) Frame = -3 Query: 571 ENFSIPKLFLLPLIPQNTLSFFFTSRILWRLLSNITFT 458 + ++ L +L + T + TS +W +L+ +TF+ Sbjct: 24 QKLTLSPLKVLQTVILGTTCIYLTSLYIWFILTQMTFS 61 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/38 (23%), Positives = 20/38 (52%) Frame = -3 Query: 571 ENFSIPKLFLLPLIPQNTLSFFFTSRILWRLLSNITFT 458 + ++ L +L + T + TS +W +L+ +TF+ Sbjct: 24 QKLTLSPLKVLQTVILGTTCIYLTSLYIWFILTQMTFS 61 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 198 CYIACLEIYKRRHMCQ 151 C I E+Y H+CQ Sbjct: 258 CVIVIFELYYLSHVCQ 273 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,440 Number of Sequences: 336 Number of extensions: 3857 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -