BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0688 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 25 3.3 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 4.4 AY330178-1|AAQ16284.1| 176|Anopheles gambiae odorant-binding pr... 23 7.6 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 575 RKGRPKEIEIVKTEDALGLTITDNGAGYAFIKR 673 R+ + E+++ + LGL+I +NG+ FI R Sbjct: 134 RRNNLRGEELLQMVEVLGLSILNNGSAPTFIGR 166 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +2 Query: 530 LLGGQIGLEDFIFAHRKGRPKEIEIVKTEDALGLTITDNGAGYAF 664 LL G + + +PK I +++ + LGL + + G + F Sbjct: 117 LLAGDFNAWHTAWGSERTKPKGIALLQLVNGLGLEVLNIGTSHTF 161 >AY330178-1|AAQ16284.1| 176|Anopheles gambiae odorant-binding protein AgamOBP51 protein. Length = 176 Score = 23.4 bits (48), Expect = 7.6 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 576 LCAKIKSSNPICPP 535 LC K++S +CPP Sbjct: 163 LCEKVRSGVAVCPP 176 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 732,996 Number of Sequences: 2352 Number of extensions: 15057 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -