BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0686 (600 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC513.05 |ams1||alpha-mannosidase |Schizosaccharomyces pombe|c... 29 0.69 SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces p... 25 8.5 >SPAC513.05 |ams1||alpha-mannosidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1077 Score = 28.7 bits (61), Expect = 0.69 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +3 Query: 339 VIRTWARRKGIGD-FPX-QDMCSVNLEDIVIKLGHPEVY 449 ++R+WA + I D +P Q +CS L+ + +K HP+V+ Sbjct: 306 IVRSWATQMNIMDRYPEYQFVCSQALQYLWLKEDHPDVF 344 >SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 2280 Score = 25.0 bits (52), Expect = 8.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 485 EREHVLARALVHVHLGVTKFDH 420 + EH+L ++V H G KF H Sbjct: 1051 QMEHILKSSVVESHYGDAKFSH 1072 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,870,625 Number of Sequences: 5004 Number of extensions: 29429 Number of successful extensions: 71 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -